Lipase LipC12 from a wastewater treatment plant lagoon metagenomic library
Enzyme Description
Species
Na (wastewater treatment plant lagoon metagenomic library)
Extremophile
No
EC Number
Sequence
MSASSLKFPIVLVHGLLGFDKIGGIYPYFYGIKEALEKAGAKVYIATLSALNSNELRGEQLLEFVRKVQAETGAAKVNLIGHSQGPLACRYVAATHPELIASVTSVNGVNHGSEVADLVRLALTPGRLPESIANAAMSAFGQLLSALAGSPRLPQSGIEALEALTSEGVAAFNNKYPQGLPAEWGGEGKELVNGVYYYSWSGVIDYNPLHQGANNLDPLHVAMLAFSILFTNERFQNDGLVGRYSSHLGKVIGSDYSMDHVDAINQLAGVVANNTDPVQLFVEHVARLKSKGL
Arnaldo Glogauer et al. (2011)
β Identification and characterization of a new true lipase isolated through metagenomic approach
Microbial Cell Factories
Β· doi:10.1186/1475-2859-10-54 β
Β· Stability - Incubation
▼
Database ID
UniParc: UPI00021B5F20 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (22 measurements)
22 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (48 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Tetrahydrofuran (THF) | 30% | 100.0 | 1690.6 | % | Incubation: 200 mM Tris-HCl, 5 mM CaCl2, Assay: 50 mM Tris-HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 1% acetonitrile, 4% isopropanol | Incubation: 8, Assay: 7.5 | Incubation: 4Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), activity measured in aqueous phase | Highly diluted organic solvent so aqueous phase for assay |
| Stability - Incubation | Activity after incubation (48 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Acetonitrile | 30% | 100.0 | 316.2 | % | Incubation: 200 mM Tris-HCl, 5 mM CaCl2, Assay: 50 mM Tris-HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 1% acetonitrile, 4% isopropanol | Incubation: 8, Assay: 7.5 | Incubation: 4Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), activity measured in aqueous phase | Highly diluted organic solvent so aqueous phase for assay |
| Stability - Incubation | Activity after incubation (48 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Acetonitrile | 15% | 100.0 | 62.7 | % | Incubation: 200 mM Tris-HCl, 5 mM CaCl2, Assay: 50 mM Tris-HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 1% acetonitrile, 4% isopropanol | Incubation: 8, Assay: 7.5 | Incubation: 4Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), activity measured in aqueous phase | Highly diluted organic solvent so aqueous phase for assay |
| Stability - Incubation | Activity after incubation (48 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Dimethylformamide (DMF) | 30% | 100.0 | 355.9 | % | Incubation: 200 mM Tris-HCl, 5 mM CaCl2, Assay: 50 mM Tris-HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 1% acetonitrile, 4% isopropanol | Incubation: 8, Assay: 7.5 | Incubation: 4Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), activity measured in aqueous phase | Highly diluted organic solvent so aqueous phase for assay |
| Stability - Incubation | Activity after incubation (48 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Dimethylformamide (DMF) | 15% | 100.0 | 223.1 | % | Incubation: 200 mM Tris-HCl, 5 mM CaCl2, Assay: 50 mM Tris-HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 1% acetonitrile, 4% isopropanol | Incubation: 8, Assay: 7.5 | Incubation: 4Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), activity measured in aqueous phase | Highly diluted organic solvent so aqueous phase for assay |
| Stability - Incubation | Activity after incubation (48 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 30% | 100.0 | 770.1 | % | Incubation: 200 mM Tris-HCl, 5 mM CaCl2, Assay: 50 mM Tris-HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 1% acetonitrile, 4% isopropanol | Incubation: 8, Assay: 7.5 | Incubation: 4Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), activity measured in aqueous phase | Highly diluted organic solvent so aqueous phase for assay |
| Stability - Incubation | Activity after incubation (48 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 15% | 100.0 | 263.7 | % | Incubation: 200 mM Tris-HCl, 5 mM CaCl2, Assay: 50 mM Tris-HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 1% acetonitrile, 4% isopropanol | Incubation: 8, Assay: 7.5 | Incubation: 4Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), activity measured in aqueous phase | Highly diluted organic solvent so aqueous phase for assay |
| Stability - Incubation | Activity after incubation (48 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | 1,4-Dioxane | 30% | 100.0 | 509.7 | % | Incubation: 200 mM Tris-HCl, 5 mM CaCl2, Assay: 50 mM Tris-HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 1% acetonitrile, 4% isopropanol | Incubation: 8, Assay: 7.5 | Incubation: 4Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), activity measured in aqueous phase | Highly diluted organic solvent so aqueous phase for assay |
| Stability - Incubation | Activity after incubation (48 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | 1,4-Dioxane | 15% | 100.0 | 505.4 | % | Incubation: 200 mM Tris-HCl, 5 mM CaCl2, Assay: 50 mM Tris-HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 1% acetonitrile, 4% isopropanol | Incubation: 8, Assay: 7.5 | Incubation: 4Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), activity measured in aqueous phase | Highly diluted organic solvent so aqueous phase for assay |
| Stability - Incubation | Activity after incubation (48 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Acetone | 30% | 100.0 | 624.2 | % | Incubation: 200 mM Tris-HCl, 5 mM CaCl2, Assay: 50 mM Tris-HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 1% acetonitrile, 4% isopropanol | Incubation: 8, Assay: 7.5 | Incubation: 4Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), activity measured in aqueous phase | Highly diluted organic solvent so aqueous phase for assay |
| Stability - Incubation | Activity after incubation (48 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Acetone | 15% | 100.0 | 66.5 | % | Incubation: 200 mM Tris-HCl, 5 mM CaCl2, Assay: 50 mM Tris-HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 1% acetonitrile, 4% isopropanol | Incubation: 8, Assay: 7.5 | Incubation: 4Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), activity measured in aqueous phase | Highly diluted organic solvent so aqueous phase for assay |
| Stability - Incubation | Activity after incubation (48 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Methanol | 15% | 100.0 | 1204.1 | % | Incubation: 200 mM Tris-HCl, 5 mM CaCl2, Assay: 50 mM Tris-HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 1% acetonitrile, 4% isopropanol | Incubation: 8, Assay: 7.5 | Incubation: 4Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), activity measured in aqueous phase | Highly diluted organic solvent so aqueous phase for assay |
| Stability - Incubation | Activity after incubation (48 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Tetrahydrofuran (THF) | 15% | 100.0 | 463.6 | % | Incubation: 200 mM Tris-HCl, 5 mM CaCl2, Assay: 50 mM Tris-HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 1% acetonitrile, 4% isopropanol | Incubation: 8, Assay: 7.5 | Incubation: 4Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), activity measured in aqueous phase | Highly diluted organic solvent so aqueous phase for assay |
| Stability - Incubation | Activity after incubation (48 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Glycerol | 30% | 100.0 | 233.0 | % | Incubation: 200 mM Tris-HCl, 5 mM CaCl2, Assay: 50 mM Tris-HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 1% acetonitrile, 4% isopropanol | Incubation: 8, Assay: 7.5 | Incubation: 4Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), activity measured in aqueous phase | Highly diluted organic solvent so aqueous phase for assay |
| Stability - Incubation | Activity after incubation (48 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Glycerol | 15% | 100.0 | 167.8 | % | Incubation: 200 mM Tris-HCl, 5 mM CaCl2, Assay: 50 mM Tris-HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 1% acetonitrile, 4% isopropanol | Incubation: 8, Assay: 7.5 | Incubation: 4Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), activity measured in aqueous phase | Highly diluted organic solvent so aqueous phase for assay |
| Stability - Incubation | Activity after incubation (48 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Isopropanol | 30% | 100.0 | 696.2 | % | Incubation: 200 mM Tris-HCl, 5 mM CaCl2, Assay: 50 mM Tris-HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 1% acetonitrile, 4% isopropanol | Incubation: 8, Assay: 7.5 | Incubation: 4Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), activity measured in aqueous phase | Highly diluted organic solvent so aqueous phase for assay |
| Stability - Incubation | Activity after incubation (48 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Isopropanol | 15% | 100.0 | 170.6 | % | Incubation: 200 mM Tris-HCl, 5 mM CaCl2, Assay: 50 mM Tris-HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 1% acetonitrile, 4% isopropanol | Incubation: 8, Assay: 7.5 | Incubation: 4Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), activity measured in aqueous phase | Highly diluted organic solvent so aqueous phase for assay |
| Stability - Incubation | Activity after incubation (48 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | 1-Propanol | 30% | 100.0 | 1161.9 | % | Incubation: 200 mM Tris-HCl, 5 mM CaCl2, Assay: 50 mM Tris-HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 1% acetonitrile, 4% isopropanol | Incubation: 8, Assay: 7.5 | Incubation: 4Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), activity measured in aqueous phase | Highly diluted organic solvent so aqueous phase for assay |
| Stability - Incubation | Activity after incubation (48 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | 1-Propanol | 15% | 100.0 | 329.0 | % | Incubation: 200 mM Tris-HCl, 5 mM CaCl2, Assay: 50 mM Tris-HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 1% acetonitrile, 4% isopropanol | Incubation: 8, Assay: 7.5 | Incubation: 4Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), activity measured in aqueous phase | Highly diluted organic solvent so aqueous phase for assay |
| Stability - Incubation | Activity after incubation (48 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Ethanol | 30% | 100.0 | 428.4 | % | Incubation: 200 mM Tris-HCl, 5 mM CaCl2, Assay: 50 mM Tris-HCl, 1 mM CaCl2, 0.3% (v/v) Triton X-100, 1% acetonitrile, 4% isopropanol | Incubation: 8, Assay: 7.5 | Incubation: 4Β°C, Assay: 30Β°C | 1 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), activity measured in aqueous phase | Highly diluted organic solvent so aqueous phase for assay |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.