Short-chain alcohol dehydrogenase from Thermococcus sibiricus

Enzyme Description

Species
Thermococcus sibiricus β†—
Extremophile
Yes "hyperthermophilic" organism
EC Number
1.1.1.1 β†—

Sequence

Length: 234 amino acids
MKVAVITGASRGIGEAIARALARDGYALALGARSVDRLEKIAHELMQEQGVEVFYHHLDVSKAESVEEFSKKVLERFGDVDVVVANAGLGYFKRLEELSEEEFHEMIEVNLLGVWRTLKAFLDSLKRTGGLALVTTSDVSARLIPYGGGYVSTKWAARALVRTFQIENPDVRFFELRPGAVDTYFGGSKPGKPKEKGYLKPDEIAEAVRCLLKLPKDVRVEELMLRSVYQRPEY
Tatiana N. Stekhanova et al. (2010) β€” Characterization of a Thermostable Short-Chain Alcohol Dehydrogenase from the Hyperthermophilic Archaeon Thermococcus sibiricus
Applied and Environmental Microbiology  Β· doi:10.1128/AEM.02797-09 β†—  Β· Activity - Classical Stability - Incubation
24 measurements ▼
Database ID
UniProt: C6A190 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli Rosetta-gami (DE3)

Experimental Data (24 measurements)

24 measurements β€” page 1 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent Ethyl Acetate Saturation 100 0 % 50 mM Gly-NaOH buffer without NaCl 10.5 60Β°C 250 mM Isopropanol Propanone NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent n-Decane Saturation 100 107 % 50 mM Gly-NaOH buffer with 600 mM NaCl 10.5 60Β°C 250 mM Isopropanol Propanone NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent n-Hexane Saturation 100 118 % 50 mM Gly-NaOH buffer with 600 mM NaCl 10.5 60Β°C 250 mM Isopropanol Propanone NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent Chloroform Saturation 100 81 % 50 mM Gly-NaOH buffer with 600 mM NaCl 10.5 60Β°C 250 mM Isopropanol Propanone NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent Ethyl Acetate Saturation 100 33 % 50 mM Gly-NaOH buffer with 600 mM NaCl 10.5 60Β°C 250 mM Isopropanol Propanone NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 50% 100 0 % 50 mM Gly-NaOH buffer with 600 mM NaCl 10.5 60Β°C 250 mM Isopropanol Propanone NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 50% 100 9 % 50 mM Gly-NaOH buffer with 600 mM NaCl 10.5 60Β°C 250 mM Isopropanol Propanone NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent Dimethylformamide (DMF) 50% 100 41 % 50 mM Gly-NaOH buffer with 600 mM NaCl 10.5 60Β°C 250 mM Isopropanol Propanone NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 50% 100 40 % 50 mM Gly-NaOH buffer with 600 mM NaCl 10.5 60Β°C 250 mM Isopropanol Propanone NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent n-Decane Saturation 100 91 % 50 mM Gly-NaOH buffer without NaCl 10.5 60Β°C 250 mM Isopropanol Propanone NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent n-Hexane Saturation 100 60 % 50 mM Gly-NaOH buffer without NaCl 10.5 60Β°C 250 mM Isopropanol Propanone NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent Chloroform Saturation 100 79 % 50 mM Gly-NaOH buffer without NaCl 10.5 60Β°C 250 mM Isopropanol Propanone NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 50% 100 0 % 50 mM Gly-NaOH buffer without NaCl 10.5 60Β°C 250 mM Isopropanol Propanone NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 50% 100 25 % 50 mM Gly-NaOH buffer without NaCl 10.5 60Β°C 250 mM Isopropanol Propanone NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent Dimethylformamide (DMF) 50% 100 13 % 50 mM Gly-NaOH buffer without NaCl 10.5 60Β°C 250 mM Isopropanol Propanone NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 50% 100 0 % 50 mM Gly-NaOH buffer without NaCl 10.5 60Β°C 250 mM Isopropanol Propanone NADP+ β€” Classical aqueous control (in %)
Stability - Incubation Activity after incubation (4 hours at 55Β°C), measured by absorance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 50% 100 98 % Incubation: 50 mM Gly-NaOH, Assay: 50 mM Gly-NaOH Incubation: 10.5, Assay: 10.5 Incubation: 55Β°C, Assay: 60Β°C 250 mM Isopropanol Propanone NADP+ β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 55Β°C), measured by absorance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in aqueous phase n-Decane 50% 100 36 % Incubation: 50 mM Gly-NaOH, Assay: 50 mM Gly-NaOH Incubation: 10.5, Assay: 10.5 Incubation: 55Β°C, Assay: 60Β°C 250 mM Isopropanol Propanone NADP+ β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 55Β°C), measured by absorance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in aqueous phase n-Hexane 50% 100 105 % Incubation: 50 mM Gly-NaOH, Assay: 50 mM Gly-NaOH Incubation: 10.5, Assay: 10.5 Incubation: 55Β°C, Assay: 60Β°C 250 mM Isopropanol Propanone NADP+ β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 55Β°C), measured by absorance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in aqueous phase Chloroform 50% 100 105 % Incubation: 50 mM Gly-NaOH, Assay: 50 mM Gly-NaOH Incubation: 10.5, Assay: 10.5 Incubation: 55Β°C, Assay: 60Β°C 250 mM Isopropanol Propanone NADP+ β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase
β€Ή Prev
1 2
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

🧬

No structure available for this protein.