Short-chain alcohol dehydrogenase from Thermococcus sibiricus

Enzyme Description

Extremophile
Yes "hyperthermophilic" organism
EC Number

Sequence

Length: 234 amino acids
MKVAVITGASRGIGEAIARALARDGYALALGARSVDRLEKIAHELMQEQGVEVFYHHLDVSKAESVEEFSKKVLERFGDVDVVVANAGLGYFKRLEELSEEEFHEMIEVNLLGVWRTLKAFLDSLKRTGGLALVTTSDVSARLIPYGGGYVSTKWAARALVRTFQIENPDVRFFELRPGAVDTYFGGSKPGKPKEKGYLKPDEIAEAVRCLLKLPKDVRVEELMLRSVYQRPEY
Tatiana N. Stekhanova et al. (2010) β€” Characterization of a Thermostable Short-Chain Alcohol Dehydrogenase from the Hyperthermophilic Archaeon Thermococcus sibiricus
Applied and Environmental Microbiology  Β· doi:10.1128/AEM.02797-09 β†—  Β· Activity - Classical Stability - Incubation
24 measurements
Database ID
UniProt: C6A190 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli Rosetta-gami (DE3)

Experimental Data (24 measurements)

24 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (4 hours at 55Β°C), measured by absorance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in aqueous phase Ethyl Acetate 50% 100 47 % Incubation: 50 mM Gly-NaOH, Assay: 50 mM Gly-NaOH Incubation: 10.5, Assay: 10.5 Incubation: 55Β°C, Assay: 60Β°C 250 mM Isopropanol Propanone NADP+ β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 55Β°C), measured by absorance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in aqueous phase Acetonitrile 50% 100 95 % Incubation: 50 mM Gly-NaOH, Assay: 50 mM Gly-NaOH Incubation: 10.5, Assay: 10.5 Incubation: 55Β°C, Assay: 60Β°C 250 mM Isopropanol Propanone NADP+ β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 55Β°C), measured by absorance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in aqueous phase Methanol 50% 100 98 % Incubation: 50 mM Gly-NaOH, Assay: 50 mM Gly-NaOH Incubation: 10.5, Assay: 10.5 Incubation: 55Β°C, Assay: 60Β°C 250 mM Isopropanol Propanone NADP+ β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 55Β°C), measured by absorance spectrophotometry (change in NADPH absorbance measurement, 340 nm) in aqueous phase Dimethylformamide (DMF) 50% 100 101 % Incubation: 50 mM Gly-NaOH, Assay: 50 mM Gly-NaOH Incubation: 10.5, Assay: 10.5 Incubation: 55Β°C, Assay: 60Β°C 250 mM Isopropanol Propanone NADP+ β€” Water-incubated control (in %), assay in aqueous phase | Uncertainty about whether activity was really measured in aqueous phase
1 2
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

🧬

No structure available for this protein.