Esterase A from Picrophilus torridus DSM 9790

Enzyme Description

Species

Picrophilus torridus DSM 9790 ↗

Extremophile

Yes extremely thermoacidophilic organism

EC Number

3.1.1.1 ↗

Sequence

Length: 192 amino acids

MIDDMYTEVHSKKVHYIESGNGKPFLLFHGARFNARTWEETGTIDALSGAGFRAISVDFPGFGKSDRSDQNLPDFINEFIDAMGLEKPIVLGASMGGEAVLGFSVKYENYSGIVLVGAVGVSQYENELNKISGKPFLLIWGKNDMVSSPANYQMLMKYNKDAKFINVGYQHACYLDDNKSFNNEIVNFAKSL

Matthias Hess et al. (2008) — Extremely thermostable esterases from the thermoacidophilic euryarchaeon Picrophilus torridus

Extremophiles · doi:10.1007/s00792-008-0139-9 ↗ · Activity + Stability - Incubation

26 measurements ▼

Database ID

UniProt: Q6L0C9 ↗

Sequence Annotation

Explicit - Provided

Protein Source

Recombinant, host bacterium Escherichia coli RosettaTM (DE3)

Experimental Data (26 measurements)

26 measurements — page 1 of 2

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Pyridine	90%	100	0	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Toluene	90%	100	199	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	n-Hexane	90%	100	43	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	1-Decanol	90%	100	0	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Isooctane	90%	100	0	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	n-Hexadecane	90%	100	61	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	n-Heptane	90%	100	0	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Formaldehyde	90%	100	0	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Chloroform	90%	100	33	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Benzene	90%	100	43	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	1-Pentanol	90%	100	0	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	tert-Butanol	90%	100	113	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	tert-Butanol	50%	100	71	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Acetone	50%	100	82	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Pyridine	50%	100	6	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Methanol	90%	100	27	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Methanol	50%	100	78	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Isopropanol	90%	100	53	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Isopropanol	50%	100	63	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Ethanol	90%	100	0	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")

Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Pyridine	90%	100	0	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Toluene	90%	100	199	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	n-Hexane	90%	100	43	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	1-Decanol	90%	100	0	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Isooctane	90%	100	0	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	n-Hexadecane	90%	100	61	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	n-Heptane	90%	100	0	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Formaldehyde	90%	100	0	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Chloroform	90%	100	33	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Benzene	90%	100	43	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	1-Pentanol	90%	100	0	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	tert-Butanol	90%	100	113	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	tert-Butanol	50%	100	71	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Acetone	50%	100	82	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Pyridine	50%	100	6	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Methanol	90%	100	27	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Methanol	50%	100	78	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Isopropanol	90%	100	53	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Isopropanol	50%	100	63	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Ethanol	90%	100	0	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Ethanol	50%	100	77	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	90%	100	0	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	50%	100	77	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethylformamide (DMF)	90%	100	165	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Dimethylformamide (DMF)	50%	100	72	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent	Acetone	90%	100	0	%	Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic	Incubation: 7, Assay: 7	Incubation: Room temperature, Assay: 70°C	2 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity \| Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")

‹ Prev

1 2

Next ›

Visualization : Activity + Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*