Esterase A from Picrophilus torridus DSM 9790

Enzyme Description

Extremophile
Yes extremely thermoacidophilic organism
EC Number

Sequence

Length: 192 amino acids
MIDDMYTEVHSKKVHYIESGNGKPFLLFHGARFNARTWEETGTIDALSGAGFRAISVDFPGFGKSDRSDQNLPDFINEFIDAMGLEKPIVLGASMGGEAVLGFSVKYENYSGIVLVGAVGVSQYENELNKISGKPFLLIWGKNDMVSSPANYQMLMKYNKDAKFINVGYQHACYLDDNKSFNNEIVNFAKSL
Matthias Hess et al. (2008) β€” Extremely thermostable esterases from the thermoacidophilic euryarchaeon Picrophilus torridus
Extremophiles  Β· doi:10.1007/s00792-008-0139-9 β†—  Β· Activity + Stability - Incubation
26 measurements
Database ID
UniProt: Q6L0C9 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli RosettaTM (DE3)

Experimental Data (26 measurements)

26 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent Ethanol 50% 100 77 % Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic Incubation: 7, Assay: 7 Incubation: Room temperature, Assay: 70Β°C 2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 90% 100 0 % Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic Incubation: 7, Assay: 7 Incubation: Room temperature, Assay: 70Β°C 2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 50% 100 77 % Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic Incubation: 7, Assay: 7 Incubation: Room temperature, Assay: 70Β°C 2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent Dimethylformamide (DMF) 90% 100 165 % Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic Incubation: 7, Assay: 7 Incubation: Room temperature, Assay: 70Β°C 2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent Dimethylformamide (DMF) 50% 100 72 % Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic Incubation: 7, Assay: 7 Incubation: Room temperature, Assay: 70Β°C 2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
Activity + Stability - Incubation Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent Acetone 90% 100 0 % Incubation: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic, Assay: 50 mM Tris-HCl and 0.1 % (w/v) gum Arabic Incubation: 7, Assay: 7 Incubation: Room temperature, Assay: 70Β°C 2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity | Not completely sure if the assay in the presence of organic solvent ("The concentration of the additive during the standard assay was as follows: 10 mM inhibitor, 10% detergent, and 50% (v/v) or 90% (v/v) organic solvent.")
1 2
Next β€Ί

Visualization : Activity + Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*