Esterase (gene EstR) from Ralstonia sp. M1
Enzyme Description
Sequence
MIQTVLIAVALVIAAPVAFTFVIARRVTKAFPPEGKFIDIGADRVHYTDRGQGPAIVFVHGLCGNLRNFAYLDLERLAQSHRVIVIDRPGSGRSLRGAASTANIYAQARTVAQCIQKLGLDQPVLVGHSLGGAIALAVGLNHPQSVRRLALVAPLTHNEHAPPGAFKGLALTSPLARRLVSWTLAVPLSILNSRKAIAAVFAPEAMPEDFPFKGGGLLGLRPHVFYAASSDLVAAPEDLPDMERRYASMTVPVDVLYGRGDRILNVKRQGEALKQKLERVNLRVVDGGHMLPVTQPALTTDWILGVAAAVPIQAEAAASA
Dinh Thi Quyen et al. (2007)
β A novel esterase from Ralstonia sp. M1: Gene cloning, sequencing, high-level expression and characterization
Protein Expression and Purification
Β· doi:10.1016/j.pep.2006.06.009 β
Β· Stability - Incubation
▼
Database ID
UniProt: Q6EIR0 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21
Experimental Data (26 measurements)
26 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Methanol | 30% | 100 | 110 | % | Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 55Β°C | 10 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Dimethylformamide (DMF) | 30% | 100 | 97 | % | Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 55Β°C | 10 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 30% | 100 | 96 | % | Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 55Β°C | 10 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | n-Hexane | 30% | 100 | 88 | % | Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 55Β°C | 10 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Ethanolamine | 30% | 100 | 1482 | % | Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 55Β°C | 10 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Acetone | 30% | 100 | 68 | % | Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 55Β°C | 10 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Acetonitrile | 30% | 100 | 99 | % | Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 55Β°C | 10 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Ethyl Acetate | 30% | 100 | 69 | % | Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 55Β°C | 10 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Dichloromethane | 30% | 100 | 78 | % | Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 55Β°C | 10 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | tert-Butanol | 30% | 100 | 22 | % | Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 55Β°C | 10 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | 1-Butanol | 30% | 100 | 14 | % | Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 55Β°C | 10 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Isopropanol | 30% | 100 | 90 | % | Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 55Β°C | 10 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Ethanol | 30% | 100 | 104 | % | Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 55Β°C | 10 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Methanol | 10% | 100 | 98 | % | Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 55Β°C | 10 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Dimethylformamide (DMF) | 10% | 100 | 96 | % | Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 55Β°C | 10 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 10% | 100 | 87 | % | Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 55Β°C | 10 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | n-Hexane | 10% | 100 | 99 | % | Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 55Β°C | 10 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Ethanolamine | 10% | 100 | 569 | % | Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 55Β°C | 10 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Acetone | 10% | 100 | 88 | % | Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 55Β°C | 10 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Acetonitrile | 10% | 100 | 90 | % | Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 55Β°C | 10 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.