Esterase (gene EstR) from Ralstonia sp. M1

Enzyme Description

Species

Extremophile

EC Number

3.1.1.1 ↗

Sequence

Length: 320 amino acids

MIQTVLIAVALVIAAPVAFTFVIARRVTKAFPPEGKFIDIGADRVHYTDRGQGPAIVFVHGLCGNLRNFAYLDLERLAQSHRVIVIDRPGSGRSLRGAASTANIYAQARTVAQCIQKLGLDQPVLVGHSLGGAIALAVGLNHPQSVRRLALVAPLTHNEHAPPGAFKGLALTSPLARRLVSWTLAVPLSILNSRKAIAAVFAPEAMPEDFPFKGGGLLGLRPHVFYAASSDLVAAPEDLPDMERRYASMTVPVDVLYGRGDRILNVKRQGEALKQKLERVNLRVVDGGHMLPVTQPALTTDWILGVAAAVPIQAEAAASA

Dinh Thi Quyen et al. (2007) — A novel esterase from Ralstonia sp. M1: Gene cloning, sequencing, high-level expression and characterization

Protein Expression and Purification · doi:10.1016/j.pep.2006.06.009 ↗ · Stability - Incubation

26 measurements ▼

Database ID

UniProt: Q6EIR0 ↗

Sequence Annotation

Explicit - Provided

Protein Source

Recombinant, host bacterium Escherichia coli BL21

Experimental Data (26 measurements)

26 measurements — page 2 of 2

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Ethyl Acetate	10%	100	86	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Dichloromethane	10%	100	116	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	tert-Butanol	10%	100	86	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	1-Butanol	10%	100	19	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Isopropanol	10%	100	90	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Ethanol	10%	100	100	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase

Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Methanol	30%	100	110	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Dimethylformamide (DMF)	30%	100	97	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Dimethyl Sulfoxide (DMSO)	30%	100	96	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	n-Hexane	30%	100	88	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Ethanolamine	30%	100	1482	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Acetone	30%	100	68	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Acetonitrile	30%	100	99	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Ethyl Acetate	30%	100	69	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Dichloromethane	30%	100	78	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	tert-Butanol	30%	100	22	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	1-Butanol	30%	100	14	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Isopropanol	30%	100	90	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Ethanol	30%	100	104	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Methanol	10%	100	98	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Dimethylformamide (DMF)	10%	100	96	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Dimethyl Sulfoxide (DMSO)	10%	100	87	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	n-Hexane	10%	100	99	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Ethanolamine	10%	100	569	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Acetone	10%	100	88	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Acetonitrile	10%	100	90	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Ethyl Acetate	10%	100	86	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Dichloromethane	10%	100	116	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	tert-Butanol	10%	100	86	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	1-Butanol	10%	100	19	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Isopropanol	10%	100	90	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 30°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Ethanol	10%	100	100	%	Incubation: 0.1 M Tris-HCl, Assay: 0.1 M Tris-HCl	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 55°C	10 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay really was in aqueous phase

‹ Prev

1 2

Next ›

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*