R-specific alcohol dehydrogenase from Lactobacillus brevis
Enzyme Description
Sequence
MSNRLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITGRHSDVGEKAAKSVGTPDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLPGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTAQ
Jan Schumacher et al. (2006)
β Influence of water-miscible organic solvents on kinetics and enantioselectivity of the (R,-specific alcohol dehydrogenase from Lactobacillus brevis
Biotechnology Journal
Β· doi:10.1002/biot.200600039 β
Β· Activity - Michaelis-Menten Specificity - Enantioselectivity Stability - Half-life
▼
Database ID
UniProt: Q84EX5 β
Sequence Annotation
Inferred - from protein name
Protein Source
Commercially purchased
Experimental Data (32 measurements)
32 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Michaelis-Menten | Vmax measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) | Acetonitrile | 4.3% | 1.08 | 1.05 | ? Units | 50 mM potassium phosphate buffer, 1 mM MgClβ, 1200 mM 2-propanol (cofactor regeneration) | 7 | 30Β°C | 2-Butanone | 2-Butanol | 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration | β | Classical aqueous control (in ? Units) |
| Activity - Michaelis-Menten | Ks (in mM) measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) | 1,4-Dioxane | 34.3% | 0.09 | 1.51 | mM | 50 mM potassium phosphate buffer, 1 mM MgClβ, 1200 mM 2-propanol (cofactor regeneration) | 7 | 30Β°C | 2-Butanone | 2-Butanol | 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration | β | Classical aqueous control (in mM) |
| Activity - Michaelis-Menten | Ks (in mM) measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) | 1,4-Dioxane | 19.8% | 0.09 | 0.62 | mM | 50 mM potassium phosphate buffer, 1 mM MgClβ, 1200 mM 2-propanol (cofactor regeneration) | 7 | 30Β°C | 2-Butanone | 2-Butanol | 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration | β | Classical aqueous control (in mM) |
| Activity - Michaelis-Menten | Ks (in mM) measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) | 1,4-Dioxane | 10.8% | 0.09 | 0.38 | mM | 50 mM potassium phosphate buffer, 1 mM MgClβ, 1200 mM 2-propanol (cofactor regeneration) | 7 | 30Β°C | 2-Butanone | 2-Butanol | 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration | β | Classical aqueous control (in mM) |
| Activity - Michaelis-Menten | Ks (in mM) measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) | 1,4-Dioxane | 6.7% | 0.09 | 0.1 | mM | 50 mM potassium phosphate buffer, 1 mM MgClβ, 1200 mM 2-propanol (cofactor regeneration) | 7 | 30Β°C | 2-Butanone | 2-Butanol | 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration | β | Classical aqueous control (in mM) |
| Activity - Michaelis-Menten | Ks (in mM) measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) | Acetonitrile | 24.5% | 0.09 | 4.59 | mM | 50 mM potassium phosphate buffer, 1 mM MgClβ, 1200 mM 2-propanol (cofactor regeneration) | 7 | 30Β°C | 2-Butanone | 2-Butanol | 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration | β | Classical aqueous control (in mM) |
| Activity - Michaelis-Menten | Ks (in mM) measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) | Acetonitrile | 13.3% | 0.09 | 1.17 | mM | 50 mM potassium phosphate buffer, 1 mM MgClβ, 1200 mM 2-propanol (cofactor regeneration) | 7 | 30Β°C | 2-Butanone | 2-Butanol | 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration | β | Classical aqueous control (in mM) |
| Activity - Michaelis-Menten | Ks (in mM) measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) | Acetonitrile | 7% | 0.09 | 0.41 | mM | 50 mM potassium phosphate buffer, 1 mM MgClβ, 1200 mM 2-propanol (cofactor regeneration) | 7 | 30Β°C | 2-Butanone | 2-Butanol | 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration | β | Classical aqueous control (in mM) |
| Activity - Michaelis-Menten | Ks (in mM) measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) | Acetonitrile | 4.3% | 0.09 | 0.15 | mM | 50 mM potassium phosphate buffer, 1 mM MgClβ, 1200 mM 2-propanol (cofactor regeneration) | 7 | 30Β°C | 2-Butanone | 2-Butanol | 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration | β | Classical aqueous control (in mM) |
| Activity - Michaelis-Menten | Vmax measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) | 1,4-Dioxane | 34.3% | 1.08 | 0.46 | ? Units | 50 mM potassium phosphate buffer, 1 mM MgClβ, 1200 mM 2-propanol (cofactor regeneration) | 7 | 30Β°C | 2-Butanone | 2-Butanol | 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration | β | Classical aqueous control (in ? Units) |
| Activity - Michaelis-Menten | Vmax measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) | 1,4-Dioxane | 19.8% | 1.08 | 0.65 | ? Units | 50 mM potassium phosphate buffer, 1 mM MgClβ, 1200 mM 2-propanol (cofactor regeneration) | 7 | 30Β°C | 2-Butanone | 2-Butanol | 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration | β | Classical aqueous control (in ? Units) |
| Activity - Michaelis-Menten | Vmax measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) | 1,4-Dioxane | 10.8% | 1.08 | 0.8 | ? Units | 50 mM potassium phosphate buffer, 1 mM MgClβ, 1200 mM 2-propanol (cofactor regeneration) | 7 | 30Β°C | 2-Butanone | 2-Butanol | 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration | β | Classical aqueous control (in ? Units) |
| Activity - Michaelis-Menten | Vmax measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) | 1,4-Dioxane | 6.7% | 1.08 | 0.84 | ? Units | 50 mM potassium phosphate buffer, 1 mM MgClβ, 1200 mM 2-propanol (cofactor regeneration) | 7 | 30Β°C | 2-Butanone | 2-Butanol | 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration | β | Classical aqueous control (in ? Units) |
| Activity - Michaelis-Menten | Vmax measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) | Acetonitrile | 24.5% | 1.08 | 0.96 | ? Units | 50 mM potassium phosphate buffer, 1 mM MgClβ, 1200 mM 2-propanol (cofactor regeneration) | 7 | 30Β°C | 2-Butanone | 2-Butanol | 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration | β | Classical aqueous control (in ? Units) |
| Activity - Michaelis-Menten | Vmax measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) | Acetonitrile | 13.3% | 1.08 | 1.1 | ? Units | 50 mM potassium phosphate buffer, 1 mM MgClβ, 1200 mM 2-propanol (cofactor regeneration) | 7 | 30Β°C | 2-Butanone | 2-Butanol | 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration | β | Classical aqueous control (in ? Units) |
| Activity - Michaelis-Menten | Vmax measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) | Acetonitrile | 7% | 1.08 | 1.14 | ? Units | 50 mM potassium phosphate buffer, 1 mM MgClβ, 1200 mM 2-propanol (cofactor regeneration) | 7 | 30Β°C | 2-Butanone | 2-Butanol | 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration | β | Classical aqueous control (in ? Units) |
| Specificity - Enantioselectivity | Enantiomeric excess determined by gas chromatography in the presence of organic solvent | 1,4-Dioxane | 34.3% | 37.0 | 40.0 | % | 50 mM potassium phosphate buffer, 1 mM MgClβ, 1200 mM 2-propanol (cofactor regeneration) | 7 | 30Β°C | 600 mM 2-Butanone | 2-Butanol | 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration | β | Classical aqueous control (in %) |
| Specificity - Enantioselectivity | Enantiomeric excess determined by gas chromatography in the presence of organic solvent | 1,4-Dioxane | 19.8% | 37.0 | 34.0 | % | 50 mM potassium phosphate buffer, 1 mM MgClβ, 1200 mM 2-propanol (cofactor regeneration) | 7 | 30Β°C | 600 mM 2-Butanone | 2-Butanol | 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration | β | Classical aqueous control (in %) |
| Specificity - Enantioselectivity | Enantiomeric excess determined by gas chromatography in the presence of organic solvent | 1,4-Dioxane | 10.8% | 37.0 | 32.0 | % | 50 mM potassium phosphate buffer, 1 mM MgClβ, 1200 mM 2-propanol (cofactor regeneration) | 7 | 30Β°C | 600 mM 2-Butanone | 2-Butanol | 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration | β | Classical aqueous control (in %) |
| Specificity - Enantioselectivity | Enantiomeric excess determined by gas chromatography in the presence of organic solvent | 1,4-Dioxane | 6.7% | 37.0 | 34.0 | % | 50 mM potassium phosphate buffer, 1 mM MgClβ, 1200 mM 2-propanol (cofactor regeneration) | 7 | 30Β°C | 600 mM 2-Butanone | 2-Butanol | 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration | β | Classical aqueous control (in %) |
Visualization : Activity β Michaelis-Menten
One bar per measurement. Colour = solvent, shade = solvent volume.
Visualization : Stability β Half-life
One bar per measurement. Colour = solvent, shade = solvent volume.
Visualization : Specificity β Enantioselectivity
One bar per measurement. Colour = solvent, shade = solvent volume.