R-specific alcohol dehydrogenase from Lactobacillus brevis

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 252 amino acids
MSNRLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITGRHSDVGEKAAKSVGTPDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDYDVRVNTVHPGYIKTPLVDDLPGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTAQ
Jan Schumacher et al. (2006) β€” Influence of water-miscible organic solvents on kinetics and enantioselectivity of the (R,-specific alcohol dehydrogenase from Lactobacillus brevis
Biotechnology Journal  Β· doi:10.1002/biot.200600039 β†—  Β· Activity - Michaelis-Menten Stability - Half-life Selectivity - Enantioselectivity
32 measurements
Database ID
UniProt: Q84EX5 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Commercially purchased

Experimental Data (32 measurements)

32 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Selectivity - Enantioselectivity Enantiomeric excess determined by gas chromatography in the presence of organic solvent Acetonitrile 24.5% 37.0 43.0 % 50 mM potassium phosphate buffer, 1 mM MgClβ‚‚, 1200 mM 2-propanol (cofactor regeneration) 7 30Β°C 600 mM 2-Butanone 2-Butanol 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration β€” Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess determined by gas chromatography in the presence of organic solvent Acetonitrile 13.3% 37.0 43.0 % 50 mM potassium phosphate buffer, 1 mM MgClβ‚‚, 1200 mM 2-propanol (cofactor regeneration) 7 30Β°C 600 mM 2-Butanone 2-Butanol 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration β€” Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess determined by gas chromatography in the presence of organic solvent Acetonitrile 7% 37.0 41.0 % 50 mM potassium phosphate buffer, 1 mM MgClβ‚‚, 1200 mM 2-propanol (cofactor regeneration) 7 30Β°C 600 mM 2-Butanone 2-Butanol 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration β€” Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess determined by gas chromatography in the presence of organic solvent Acetonitrile 4.3% 37.0 33.0 % 50 mM potassium phosphate buffer, 1 mM MgClβ‚‚, 1200 mM 2-propanol (cofactor regeneration) 7 30Β°C 600 mM 2-Butanone 2-Butanol 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration β€” Classical aqueous control (in %)
Stability - Half-life Half-life (in hours) at 30Β°C measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) Acetonitrile 4.3% 399.0 159.0 hours Incubation: 50 mM potassium phosphate buffer, 1 mM MgClβ‚‚, Assay: 50 mM potassium phosphate buffer, 1 mM MgClβ‚‚ 7 30Β°C 10 mM Acetophenone 1-Phenylethanol 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration β€” Classical aqueous control (in hours)
Stability - Half-life Half-life (in hours) at 30Β°C measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) 1,4-Dioxane 34.3% 399.0 26.0 hours Incubation: 50 mM potassium phosphate buffer, 1 mM MgClβ‚‚, Assay: 50 mM potassium phosphate buffer, 1 mM MgClβ‚‚ 7 30Β°C 10 mM Acetophenone 1-Phenylethanol 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration β€” Classical aqueous control (in hours)
Stability - Half-life Half-life (in hours) at 30Β°C measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) 1,4-Dioxane 19.8% 399.0 43.0 hours Incubation: 50 mM potassium phosphate buffer, 1 mM MgClβ‚‚, Assay: 50 mM potassium phosphate buffer, 1 mM MgClβ‚‚ 7 30Β°C 10 mM Acetophenone 1-Phenylethanol 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration β€” Classical aqueous control (in hours)
Stability - Half-life Half-life (in hours) at 30Β°C measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) 1,4-Dioxane 10.8% 399.0 45.0 hours Incubation: 50 mM potassium phosphate buffer, 1 mM MgClβ‚‚, Assay: 50 mM potassium phosphate buffer, 1 mM MgClβ‚‚ 7 30Β°C 10 mM Acetophenone 1-Phenylethanol 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration β€” Classical aqueous control (in hours)
Stability - Half-life Half-life (in hours) at 30Β°C measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) 1,4-Dioxane 6.7% 399.0 49.0 hours Incubation: 50 mM potassium phosphate buffer, 1 mM MgClβ‚‚, Assay: 50 mM potassium phosphate buffer, 1 mM MgClβ‚‚ 7 30Β°C 10 mM Acetophenone 1-Phenylethanol 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration β€” Classical aqueous control (in hours)
Stability - Half-life Half-life (in hours) at 30Β°C measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) Acetonitrile 24.5% 399.0 1.6 hours Incubation: 50 mM potassium phosphate buffer, 1 mM MgClβ‚‚, Assay: 50 mM potassium phosphate buffer, 1 mM MgClβ‚‚ 7 30Β°C 10 mM Acetophenone 1-Phenylethanol 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration β€” Classical aqueous control (in hours)
Stability - Half-life Half-life (in hours) at 30Β°C measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) Acetonitrile 13.3% 399.0 34.0 hours Incubation: 50 mM potassium phosphate buffer, 1 mM MgClβ‚‚, Assay: 50 mM potassium phosphate buffer, 1 mM MgClβ‚‚ 7 30Β°C 10 mM Acetophenone 1-Phenylethanol 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration β€” Classical aqueous control (in hours)
Stability - Half-life Half-life (in hours) at 30Β°C measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) Acetonitrile 7% 399.0 121.0 hours Incubation: 50 mM potassium phosphate buffer, 1 mM MgClβ‚‚, Assay: 50 mM potassium phosphate buffer, 1 mM MgClβ‚‚ 7 30Β°C 10 mM Acetophenone 1-Phenylethanol 6 mM NADP+, 1200 mM propan-2-ol for cofactor regeneration β€” Classical aqueous control (in hours)
1 2
Next β€Ί

Visualization : Activity β€” Michaelis-Menten

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Half-life

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Selectivity - Enantioselectivity

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*