Cholesterol esterase (gene cheS) from Burkholderia cepacia ST-200

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 364 amino acids
MARSMRSRVVAGAVACAMSVAPFAGTTALMTLATTHAAMAATAPADNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQHGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGAAKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQSVLAYDPTGLSSTVIAAFVNVFGILTSSSHNTNQDALASLKTLTTSQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTLSLFGVTGAQDTSTIPLVDPANALDPSTLALFGTGTVMINRGSGQNDGLVSKCSALYGKVLSTSYKWNHIDEINQLLGVRGAYAEDPVAVIRTHANRLQLAGV
Yasuhiko Takeda et al. (2006) β€” Purification, characterization, and molecular cloning of organic-solvent-tolerant cholesterol esterase from cyclohexane-tolerant Burkholderia cepacia strain ST-200
Extremophiles  Β· doi:10.1007/s00792-005-0494-8 β†—  Β· Activity - Classical Stability - Incubation
30 measurements
Database ID
UniProt: Q75NT4 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli

Experimental Data (30 measurements)

30 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 50% 1.0 4.3 relative units 180 mM potassium phosphate buffer 7 37Β°C 0.8 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in relative units)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20% 1.0 5.6 relative units 180 mM potassium phosphate buffer 7 37Β°C 0.8 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in relative units)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10% 1.0 5.0 relative units 180 mM potassium phosphate buffer 7 37Β°C 0.8 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in relative units)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5% 1.0 4.8 relative units 180 mM potassium phosphate buffer 7 37Β°C 0.8 mM p-Nitrophenyl caprylate Caprylic Acid , p-Nitrophenol β€” β€” Classical aqueous control (in relative units)
Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (colorimetric Allain's method, cholesterol and O2 cholesterol oxidase-catalyzed reaction produces H2O2, and H2O2 and 4-Aminoantipyrine reaction product absorbance measurement, 500 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 33% 1.0 1.1 relative units Incubation: 10 mM Tris-HCl, Assay: 0.11 M potassium phosphate Incubation: 8, Assay: 7 Incubation: 30Β°C, Assay: 37Β°C 20 mM Cholesterol linoleate Cholesterol , linoleic acid β€” β€” Non-incubated control (in relative units), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (colorimetric Allain's method, cholesterol and O2 cholesterol oxidase-catalyzed reaction produces H2O2, and H2O2 and 4-Aminoantipyrine reaction product absorbance measurement, 500 nm) in aqueous phase Isopropanol 33% 1.0 1.1 relative units Incubation: 10 mM Tris-HCl, Assay: 0.11 M potassium phosphate Incubation: 8, Assay: 7 Incubation: 30Β°C, Assay: 37Β°C 20 mM Cholesterol linoleate Cholesterol , linoleic acid β€” β€” Non-incubated control (in relative units), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (colorimetric Allain's method, cholesterol and O2 cholesterol oxidase-catalyzed reaction produces H2O2, and H2O2 and 4-Aminoantipyrine reaction product absorbance measurement, 500 nm) in aqueous phase Acetone 33% 1.0 0.53 relative units Incubation: 10 mM Tris-HCl, Assay: 0.11 M potassium phosphate Incubation: 8, Assay: 7 Incubation: 30Β°C, Assay: 37Β°C 20 mM Cholesterol linoleate Cholesterol , linoleic acid β€” β€” Non-incubated control (in relative units), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (colorimetric Allain's method, cholesterol and O2 cholesterol oxidase-catalyzed reaction produces H2O2, and H2O2 and 4-Aminoantipyrine reaction product absorbance measurement, 500 nm) in aqueous phase Ethanol 33% 1.0 0.98 relative units Incubation: 10 mM Tris-HCl, Assay: 0.11 M potassium phosphate Incubation: 8, Assay: 7 Incubation: 30Β°C, Assay: 37Β°C 20 mM Cholesterol linoleate Cholesterol , linoleic acid β€” β€” Non-incubated control (in relative units), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (colorimetric Allain's method, cholesterol and O2 cholesterol oxidase-catalyzed reaction produces H2O2, and H2O2 and 4-Aminoantipyrine reaction product absorbance measurement, 500 nm) in aqueous phase Methanol 33% 1.0 0.58 relative units Incubation: 10 mM Tris-HCl, Assay: 0.11 M potassium phosphate Incubation: 8, Assay: 7 Incubation: 30Β°C, Assay: 37Β°C 20 mM Cholesterol linoleate Cholesterol , linoleic acid β€” β€” Non-incubated control (in relative units), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (colorimetric Allain's method, cholesterol and O2 cholesterol oxidase-catalyzed reaction produces H2O2, and H2O2 and 4-Aminoantipyrine reaction product absorbance measurement, 500 nm) in aqueous phase Dimethylformamide (DMF) 33% 1.0 0.98 relative units Incubation: 10 mM Tris-HCl, Assay: 0.11 M potassium phosphate Incubation: 8, Assay: 7 Incubation: 30Β°C, Assay: 37Β°C 20 mM Cholesterol linoleate Cholesterol , linoleic acid β€” β€” Non-incubated control (in relative units), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
1 2
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*