Cholesterol esterase (gene cheS) from Burkholderia cepacia ST-200
Enzyme Description
Sequence
MARSMRSRVVAGAVACAMSVAPFAGTTALMTLATTHAAMAATAPADNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQHGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGAAKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQSVLAYDPTGLSSTVIAAFVNVFGILTSSSHNTNQDALASLKTLTTSQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTLSLFGVTGAQDTSTIPLVDPANALDPSTLALFGTGTVMINRGSGQNDGLVSKCSALYGKVLSTSYKWNHIDEINQLLGVRGAYAEDPVAVIRTHANRLQLAGV
Yasuhiko Takeda et al. (2006)
β Purification, characterization, and molecular cloning of organic-solvent-tolerant cholesterol esterase from cyclohexane-tolerant Burkholderia cepacia strain ST-200
▼
Database ID
UniProt: Q75NT4 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli
Experimental Data (30 measurements)
30 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Methanol | 10% | 1.0 | 6.8 | relative units | 180 mM potassium phosphate buffer | 7 | 37Β°C | 0.8 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Classical aqueous control (in relative units) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Acetone | 50% | 1.0 | 0.21 | relative units | 180 mM potassium phosphate buffer | 7 | 37Β°C | 0.8 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Classical aqueous control (in relative units) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Acetone | 20% | 1.0 | 3.8 | relative units | 180 mM potassium phosphate buffer | 7 | 37Β°C | 0.8 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Classical aqueous control (in relative units) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Acetone | 10% | 1.0 | 4.6 | relative units | 180 mM potassium phosphate buffer | 7 | 37Β°C | 0.8 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Classical aqueous control (in relative units) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Acetone | 5% | 1.0 | 3.5 | relative units | 180 mM potassium phosphate buffer | 7 | 37Β°C | 0.8 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Classical aqueous control (in relative units) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Isopropanol | 50% | 1.0 | 0.23 | relative units | 180 mM potassium phosphate buffer | 7 | 37Β°C | 0.8 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Classical aqueous control (in relative units) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Isopropanol | 20% | 1.0 | 5.1 | relative units | 180 mM potassium phosphate buffer | 7 | 37Β°C | 0.8 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Classical aqueous control (in relative units) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Isopropanol | 10% | 1.0 | 5.7 | relative units | 180 mM potassium phosphate buffer | 7 | 37Β°C | 0.8 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Classical aqueous control (in relative units) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Isopropanol | 5% | 1.0 | 5.8 | relative units | 180 mM potassium phosphate buffer | 7 | 37Β°C | 0.8 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Classical aqueous control (in relative units) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Ethanol | 50% | 1.0 | 0.43 | relative units | 180 mM potassium phosphate buffer | 7 | 37Β°C | 0.8 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Classical aqueous control (in relative units) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Ethanol | 20% | 1.0 | 4.6 | relative units | 180 mM potassium phosphate buffer | 7 | 37Β°C | 0.8 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Classical aqueous control (in relative units) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Ethanol | 10% | 1.0 | 5.8 | relative units | 180 mM potassium phosphate buffer | 7 | 37Β°C | 0.8 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Classical aqueous control (in relative units) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Ethanol | 5% | 1.0 | 5.4 | relative units | 180 mM potassium phosphate buffer | 7 | 37Β°C | 0.8 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Classical aqueous control (in relative units) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Methanol | 50% | 1.0 | 2.8 | relative units | 180 mM potassium phosphate buffer | 7 | 37Β°C | 0.8 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Classical aqueous control (in relative units) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Methanol | 20% | 1.0 | 7.2 | relative units | 180 mM potassium phosphate buffer | 7 | 37Β°C | 0.8 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Classical aqueous control (in relative units) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Methanol | 5% | 1.0 | 6.5 | relative units | 180 mM potassium phosphate buffer | 7 | 37Β°C | 0.8 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Classical aqueous control (in relative units) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 50% | 1.0 | 3.1 | relative units | 180 mM potassium phosphate buffer | 7 | 37Β°C | 0.8 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Classical aqueous control (in relative units) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 20% | 1.0 | 6.0 | relative units | 180 mM potassium phosphate buffer | 7 | 37Β°C | 0.8 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Classical aqueous control (in relative units) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 10% | 1.0 | 5.4 | relative units | 180 mM potassium phosphate buffer | 7 | 37Β°C | 0.8 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Classical aqueous control (in relative units) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 5% | 1.0 | 4.9 | relative units | 180 mM potassium phosphate buffer | 7 | 37Β°C | 0.8 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | β | Classical aqueous control (in relative units) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.