Alcohol dehydrogenase from Aeropyrum pernix

Enzyme Description

Extremophile
Yes "hyperthermophilic" organism
EC Number

Sequence

Length: 344 amino acids
MKAARLHEYNKPLRIEDVDYPRLEGRFDVIVRIAGAGVCHTDLHLVQGMWHELLQPKLPYTLGHENVGYIEEVAEGVEGLEKGDPVILHPAVTDGTCLACRAGEDMHCENLEFPGLNIDGGFAEFMRTSHRSVIKLPKDISREKLVEMAPLADAGITAYRAVKKAARTLYPGAYVAIVGVGGLGHIAVQLLKVMTPATVIALDVKEEKLKLAERLGADHVVDARRDPVKQVMELTRGRGVNVAMDFVGSQATVDYTPYLLGRMGRLIIVGYGGELRFPTIRVISSEVSFEGSLVGNYVELHELVTLALQGKVRVEVDIHKLDEINDVLERLEKGEVLGRAVLIP
Hidehiko Hirakawa et al. (2005) β€” Log P effect of organic solvents on a thermophilic alcohol dehydrogenase
Biochimica et Biophysica Acta (BBA) - Proteins and Proteomics  Β· doi:10.1016/j.bbapap.2004.12.007 β†—  Β· Activity - Michaelis-Menten
24 measurements
Database ID
UniProt: Q9Y9P9 β†—
Sequence Annotation
Inferred
Protein Source
Purified, archaeon Aeropyrum pernix

Experimental Data (24 measurements)

24 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Michaelis-Menten kcat (/s) measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethylformamide (DMF) 0.05 (molar fraction) 0.12 0.38 1/s 100 mM potassium phosphate 8 60Β°C 1-Pentanol Pentanal 0.1 mM NAD+ β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten kcat (/s) measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 0.2 (molar fraction) 0.12 0.28 1/s 100 mM potassium phosphate 8 60Β°C 1-Pentanol Pentanal 0.1 mM NAD+ β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten kcat (/s) measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 0.15 (molar fraction) 0.12 0.28 1/s 100 mM potassium phosphate 8 60Β°C 1-Pentanol Pentanal 0.1 mM NAD+ β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten kcat (/s) measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 0.1 (molar fraction) 0.12 0.18 1/s 100 mM potassium phosphate 8 60Β°C 1-Pentanol Pentanal 0.1 mM NAD+ β€” Classical aqueous control (in 1/s)
1 2
Next β€Ί

Visualization : Activity β€” Michaelis-Menten

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*