Alcohol dehydrogenase from Aeropyrum pernix

Enzyme Description

Species
Aeropyrum pernix β†—
Extremophile
Yes "hyperthermophilic" organism
EC Number
1.1.1.1 β†—

Sequence

Length: 344 amino acids
MKAARLHEYNKPLRIEDVDYPRLEGRFDVIVRIAGAGVCHTDLHLVQGMWHELLQPKLPYTLGHENVGYIEEVAEGVEGLEKGDPVILHPAVTDGTCLACRAGEDMHCENLEFPGLNIDGGFAEFMRTSHRSVIKLPKDISREKLVEMAPLADAGITAYRAVKKAARTLYPGAYVAIVGVGGLGHIAVQLLKVMTPATVIALDVKEEKLKLAERLGADHVVDARRDPVKQVMELTRGRGVNVAMDFVGSQATVDYTPYLLGRMGRLIIVGYGGELRFPTIRVISSEVSFEGSLVGNYVELHELVTLALQGKVRVEVDIHKLDEINDVLERLEKGEVLGRAVLIP
Hidehiko Hirakawa et al. (2005) β€” Log P effect of organic solvents on a thermophilic alcohol dehydrogenase
Biochimica et Biophysica Acta (BBA) - Proteins and Proteomics  Β· doi:10.1016/j.bbapap.2004.12.007 β†—  Β· Activity - Michaelis-Menten
24 measurements ▼
Database ID
UniProt: Q9Y9P9 β†—
Sequence Annotation
Inferred
Protein Source
Purified, archaeon Aeropyrum pernix

Experimental Data (24 measurements)

24 measurements β€” page 1 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Michaelis-Menten Km (mM) measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 0.05 (molar fraction) 0.33 0.28 mM 100 mM potassium phosphate 8 60Β°C 1-Pentanol Pentanal 0.1 mM NAD+ β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten Km (mM) measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 0.2 (molar fraction) 0.33 26.8 mM 100 mM potassium phosphate 8 60Β°C 1-Pentanol Pentanal 0.1 mM NAD+ β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten Km (mM) measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 0.15 (molar fraction) 0.33 26.9 mM 100 mM potassium phosphate 8 60Β°C 1-Pentanol Pentanal 0.1 mM NAD+ β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten Km (mM) measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 0.1 (molar fraction) 0.33 28.9 mM 100 mM potassium phosphate 8 60Β°C 1-Pentanol Pentanal 0.1 mM NAD+ β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten Km (mM) measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 0.05 (molar fraction) 0.33 6.5 mM 100 mM potassium phosphate 8 60Β°C 1-Pentanol Pentanal 0.1 mM NAD+ β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten Km (mM) measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethylformamide (DMF) 0.2 (molar fraction) 0.33 5.1 mM 100 mM potassium phosphate 8 60Β°C 1-Pentanol Pentanal 0.1 mM NAD+ β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten Km (mM) measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethylformamide (DMF) 0.15 (molar fraction) 0.33 9.1 mM 100 mM potassium phosphate 8 60Β°C 1-Pentanol Pentanal 0.1 mM NAD+ β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten Km (mM) measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethylformamide (DMF) 0.1 (molar fraction) 0.33 4.4 mM 100 mM potassium phosphate 8 60Β°C 1-Pentanol Pentanal 0.1 mM NAD+ β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten Km (mM) measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethylformamide (DMF) 0.05 (molar fraction) 0.33 1.67 mM 100 mM potassium phosphate 8 60Β°C 1-Pentanol Pentanal 0.1 mM NAD+ β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten Km (mM) measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 0.2 (molar fraction) 0.33 0.61 mM 100 mM potassium phosphate 8 60Β°C 1-Pentanol Pentanal 0.1 mM NAD+ β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten Km (mM) measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 0.15 (molar fraction) 0.33 0.41 mM 100 mM potassium phosphate 8 60Β°C 1-Pentanol Pentanal 0.1 mM NAD+ β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten Km (mM) measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 0.1 (molar fraction) 0.33 0.26 mM 100 mM potassium phosphate 8 60Β°C 1-Pentanol Pentanal 0.1 mM NAD+ β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten kcat (/s) measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 0.05 (molar fraction) 0.12 0.16 1/s 100 mM potassium phosphate 8 60Β°C 1-Pentanol Pentanal 0.1 mM NAD+ β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten kcat (/s) measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 0.2 (molar fraction) 0.12 0.65 1/s 100 mM potassium phosphate 8 60Β°C 1-Pentanol Pentanal 0.1 mM NAD+ β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten kcat (/s) measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 0.15 (molar fraction) 0.12 1.17 1/s 100 mM potassium phosphate 8 60Β°C 1-Pentanol Pentanal 0.1 mM NAD+ β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten kcat (/s) measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 0.1 (molar fraction) 0.12 1.72 1/s 100 mM potassium phosphate 8 60Β°C 1-Pentanol Pentanal 0.1 mM NAD+ β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten kcat (/s) measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 0.05 (molar fraction) 0.12 1.12 1/s 100 mM potassium phosphate 8 60Β°C 1-Pentanol Pentanal 0.1 mM NAD+ β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten kcat (/s) measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethylformamide (DMF) 0.2 (molar fraction) 0.12 0.35 1/s 100 mM potassium phosphate 8 60Β°C 1-Pentanol Pentanal 0.1 mM NAD+ β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten kcat (/s) measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethylformamide (DMF) 0.15 (molar fraction) 0.12 0.68 1/s 100 mM potassium phosphate 8 60Β°C 1-Pentanol Pentanal 0.1 mM NAD+ β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten kcat (/s) measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethylformamide (DMF) 0.1 (molar fraction) 0.12 0.54 1/s 100 mM potassium phosphate 8 60Β°C 1-Pentanol Pentanal 0.1 mM NAD+ β€” Classical aqueous control (in 1/s)
β€Ή Prev
1 2
Next β€Ί

Visualization : Activity β€” Michaelis-Menten

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*