Yeast-expressed hydroxynitrile lyase (gene PeHNL) from Passiflora edulis (passion fruit)

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 147 amino acids
MRNPGASFLIKHFLVLSLFLCAGTAHNPPEIVRHIVFNRYKSQLSQKQIDQIIADYGNLQNIAPEMKEWKWGTDLGPAVEDRADGFTHAYESTFHSVADFLNFFYSPPALEFAKEFFPACEKIVVLNYIINETFPYTWALPNKYVVT
Aem Nuylert et al. (2017) β€” Effect of Glycosylation on the Biocatalytic Properties of Hydroxynitrile Lyase from the Passion Fruit, Passiflora edulis : A Comparison of Natural and Recombinant Enzymes
ChemBioChem  Β· doi:10.1002/cbic.201600447 β†—  Β· Stability - Incubation Specificity - Enantioselectivity
24 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host yeast Pichia pastoris GS115

Experimental Data (24 measurements)

24 measurements β€” page 1 of 2
Mutation Property Assay Solvent Solvent Volume Aqueous ReferenceWT Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
WT Specificity - Enantioselectivity Enantiomeric excess (toward R form) after 12 hours incubation at 10Β°C in the presence of organic solvent, measured by HPLC n-Hexane 50% 50.4 β€” 32.2 % 400 mM citrate buffer 4 10Β°C 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
WT Specificity - Enantioselectivity Enantiomeric excess (toward R form) after 12 hours incubation at 10Β°C in the presence of organic solvent, measured by HPLC Butyl Ether 50% 50.4 β€” 94.7 % 400 mM citrate buffer 4 10Β°C 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
WT Specificity - Enantioselectivity Enantiomeric excess (toward R form) after 12 hours incubation at 10Β°C in the presence of organic solvent, measured by HPLC Diisopropyl Ether 50% 50.4 β€” 98.1 % 400 mM citrate buffer 4 10Β°C 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
WT Specificity - Enantioselectivity Enantiomeric excess (toward R form) after 12 hours incubation at 10Β°C in the presence of organic solvent, measured by HPLC Ethyl Acetate 50% 50.4 β€” 95.9 % 400 mM citrate buffer 4 10Β°C 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
WT Specificity - Enantioselectivity Enantiomeric excess (toward R form) after 12 hours incubation at 10Β°C in the presence of organic solvent, measured by HPLC Diethyl Ether 50% 50.4 β€” 95.4 % 400 mM citrate buffer 4 10Β°C 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
WT Specificity - Enantioselectivity Enantiomeric excess (toward R form) after 12 hours incubation at 10Β°C in the presence of organic solvent, measured by HPLC tert-Butyl Methyl Ether (MTBE) 50% 50.4 β€” 94.4 % 400 mM citrate buffer 4 10Β°C 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
WT Stability - Incubation Activity after incubation (12 hours at 10Β°C), measured by HPLC in presence of organic solvent Ethyl Acetate 50% 90.4 β€” 55.9 % Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer Incubation: 4, Assay: 4 ? 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
WT Stability - Incubation Activity after incubation (12 hours at 10Β°C), measured by HPLC in presence of organic solvent Diethyl Ether 50% 90.4 β€” 82.6 % Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer Incubation: 4, Assay: 4 ? 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
WT Stability - Incubation Activity after incubation (12 hours at 10Β°C), measured by HPLC in presence of organic solvent tert-Butyl Methyl Ether (MTBE) 50% 90.4 β€” 65.3 % Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer Incubation: 4, Assay: 4 ? 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
WT Stability - Incubation Activity after incubation (12 hours at 10Β°C), measured by HPLC in presence of organic solvent Diisopropyl Ether 50% 90.4 β€” 93.4 % Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer Incubation: 4, Assay: 4 ? 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
WT Stability - Incubation Activity after incubation (12 hours at 10Β°C), measured by HPLC in presence of organic solvent Butyl Ether 50% 90.4 β€” 65.0 % Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer Incubation: 4, Assay: 4 ? 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
WT Stability - Incubation Activity after incubation (12 hours at 10Β°C), measured by HPLC in presence of organic solvent n-Hexane 50% 90.4 β€” 72.4 % Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer Incubation: 4, Assay: 4 ? 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
N105Q Specificity - Enantioselectivity Enantiomeric excess (toward R form) after 12 hours incubation at 10Β°C in the presence of organic solvent, measured by HPLC n-Hexane 50% 53.3 32.2 27.8 % 400 mM citrate buffer 4 10Β°C 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
N105Q Specificity - Enantioselectivity Enantiomeric excess (toward R form) after 12 hours incubation at 10Β°C in the presence of organic solvent, measured by HPLC Butyl Ether 50% 53.3 94.7 94.9 % 400 mM citrate buffer 4 10Β°C 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
N105Q Specificity - Enantioselectivity Enantiomeric excess (toward R form) after 12 hours incubation at 10Β°C in the presence of organic solvent, measured by HPLC Diisopropyl Ether 50% 53.3 98.1 97.6 % 400 mM citrate buffer 4 10Β°C 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
N105Q Specificity - Enantioselectivity Enantiomeric excess (toward R form) after 12 hours incubation at 10Β°C in the presence of organic solvent, measured by HPLC tert-Butyl Methyl Ether (MTBE) 50% 53.3 94.4 94.7 % 400 mM citrate buffer 4 10Β°C 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
N105Q Specificity - Enantioselectivity Enantiomeric excess (toward R form) after 12 hours incubation at 10Β°C in the presence of organic solvent, measured by HPLC Diethyl Ether 50% 53.3 95.4 94.7 % 400 mM citrate buffer 4 10Β°C 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
N105Q Specificity - Enantioselectivity Enantiomeric excess (toward R form) after 12 hours incubation at 10Β°C in the presence of organic solvent, measured by HPLC Ethyl Acetate 50% 53.3 95.9 94.2 % 400 mM citrate buffer 4 10Β°C 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
N105Q Stability - Incubation Activity after incubation (12 hours at 10Β°C), measured by HPLC in presence of organic solvent n-Hexane 50% 55.4 72.4 67.8 % Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer Incubation: 4, Assay: 4 ? 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
N105Q Stability - Incubation Activity after incubation (12 hours at 10Β°C), measured by HPLC in presence of organic solvent Butyl Ether 50% 55.4 65.0 62.5 % Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer Incubation: 4, Assay: 4 ? 900 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” β€” Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value | Acetone cyanohydrin forms HCN
β€Ή Prev
1 2

Mutations in this dataset (2)

WT N105Q

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume. β€” β€” β€” Reference value. Hover for details.

Mutation Effect

Mutation impact on enzyme stability and function in the presence of organic solvent: comparison of wild-type and mutant values in identical conditions.

Visualization : Specificity β€” Enantioselectivity

One bar per measurement. Colour = solvent, shade = solvent volume. β€” β€” β€” Reference value. Hover for details.

Mutation Effect

Mutation impact on enzyme stability and function in the presence of organic solvent: comparison of wild-type and mutant values in identical conditions.

Structure

🧬

No structure available for this protein.