D-2-hydroxyacid dehydrogenase (gene D2HDH) from Haloferax mediterranei

Enzyme Description

Species
Haloferax mediterranei β†—
Extremophile
Yes "halophilic" organism
EC Number
1.1.1.28 β†—

Sequence

Length: 308 amino acids
MHIERLAVDESVGRAMPPQRFIEALSDLGVPVEFAGEDEQFGPGDAVASFGHRDAFLDADWVHCIRAGYDEFPVGVYEEAGTYLTNSTGIHGTTVGETVAGYMLTFARRLHAYRDAQHDHAWDLPRYEEPFTLAGERVCVVGLGTLGRGVVDRAAALGMEVVGVRRSGDPVDNVSTVYTPDRLHEAIADARFVVLATPLTDETEGMVAAPEFETMREDASLVNVARGPVVVESDLVAALDSGDIAGAALDVFSEEPLPEDSPLWDFEDVLITPHVSAATSKYHEDVAALIRENIEKIATGDELTNRVV
Jessica Domenech et al. (2025) β€” Potassium binding by carbonyl clusters, halophilic adaptation and catalysis of Haloferax mediterranei D-2-hydroxyacid dehydrogenase
Communications Biology  Β· doi:10.1038/s42003-025-08587-7 β†—  Β· Activity - Classical
24 measurements ▼
Database ID
PDB: 9IBE β†—
Sequence Annotation
Explicit - Provided PDB Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli

Experimental Data (24 measurements)

24 measurements β€” page 1 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Glycerol 20% 2.21 1.39 U/mg 50 mM Tris-HCl buffer, 2M NaCl 8 40Β°C 6.5 mM 2-Oxohexanoic acid D-2-hydroxyhexanoic acid 0.3 mM NADH β€” Classical aqueous control (in U/mg)
Activity - Classical Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20% 2.31 0.7 U/mg 50 mM Tris-HCl buffer, 2M NaCl 8 40Β°C 12.5 mM 2-Oxohexanoic acid D-2-hydroxyhexanoic acid 0.3 mM NADH β€” Classical aqueous control (in U/mg)
Activity - Classical Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20% 2.28 0.69 U/mg 50 mM Tris-HCl buffer, 2M NaCl 8 40Β°C 10 mM 2-Oxohexanoic acid D-2-hydroxyhexanoic acid 0.3 mM NADH β€” Classical aqueous control (in U/mg)
Activity - Classical Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20% 2.25 0.68 U/mg 50 mM Tris-HCl buffer, 2M NaCl 8 40Β°C 8 mM 2-Oxohexanoic acid D-2-hydroxyhexanoic acid 0.3 mM NADH β€” Classical aqueous control (in U/mg)
Activity - Classical Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20% 2.21 0.67 U/mg 50 mM Tris-HCl buffer, 2M NaCl 8 40Β°C 6.5 mM 2-Oxohexanoic acid D-2-hydroxyhexanoic acid 0.3 mM NADH β€” Classical aqueous control (in U/mg)
Activity - Classical Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20% 2.15 0.65 U/mg 50 mM Tris-HCl buffer, 2M NaCl 8 40Β°C 5 mM 2-Oxohexanoic acid D-2-hydroxyhexanoic acid 0.3 mM NADH β€” Classical aqueous control (in U/mg)
Activity - Classical Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20% 2.08 0.63 U/mg 50 mM Tris-HCl buffer, 2M NaCl 8 40Β°C 4 mM 2-Oxohexanoic acid D-2-hydroxyhexanoic acid 0.3 mM NADH β€” Classical aqueous control (in U/mg)
Activity - Classical Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20% 1.83 0.55 U/mg 50 mM Tris-HCl buffer, 2M NaCl 8 40Β°C 2 mM 2-Oxohexanoic acid D-2-hydroxyhexanoic acid 0.3 mM NADH β€” Classical aqueous control (in U/mg)
Activity - Classical Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20% 1.46 0.44 U/mg 50 mM Tris-HCl buffer, 2M NaCl 8 40Β°C 1 mM 2-Oxohexanoic acid D-2-hydroxyhexanoic acid 0.3 mM NADH β€” Classical aqueous control (in U/mg)
Activity - Classical Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Glycerol 20% 2.31 1.48 U/mg 50 mM Tris-HCl buffer, 2M NaCl 8 40Β°C 12.5 mM 2-Oxohexanoic acid D-2-hydroxyhexanoic acid 0.3 mM NADH β€” Classical aqueous control (in U/mg)
Activity - Classical Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Glycerol 20% 2.28 1.46 U/mg 50 mM Tris-HCl buffer, 2M NaCl 8 40Β°C 10 mM 2-Oxohexanoic acid D-2-hydroxyhexanoic acid 0.3 mM NADH β€” Classical aqueous control (in U/mg)
Activity - Classical Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Glycerol 20% 2.25 1.43 U/mg 50 mM Tris-HCl buffer, 2M NaCl 8 40Β°C 8 mM 2-Oxohexanoic acid D-2-hydroxyhexanoic acid 0.3 mM NADH β€” Classical aqueous control (in U/mg)
Activity - Classical Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 20% 1.46 1.23 U/mg 50 mM Tris-HCl buffer, 2M NaCl 8 40Β°C 1 mM 2-Oxohexanoic acid D-2-hydroxyhexanoic acid 0.3 mM NADH β€” Classical aqueous control (in U/mg)
Activity - Classical Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Glycerol 20% 2.15 1.33 U/mg 50 mM Tris-HCl buffer, 2M NaCl 8 40Β°C 5 mM 2-Oxohexanoic acid D-2-hydroxyhexanoic acid 0.3 mM NADH β€” Classical aqueous control (in U/mg)
Activity - Classical Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Glycerol 20% 2.08 1.27 U/mg 50 mM Tris-HCl buffer, 2M NaCl 8 40Β°C 4 mM 2-Oxohexanoic acid D-2-hydroxyhexanoic acid 0.3 mM NADH β€” Classical aqueous control (in U/mg)
Activity - Classical Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Glycerol 20% 1.83 1.05 U/mg 50 mM Tris-HCl buffer, 2M NaCl 8 40Β°C 2 mM 2-Oxohexanoic acid D-2-hydroxyhexanoic acid 0.3 mM NADH β€” Classical aqueous control (in U/mg)
Activity - Classical Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Glycerol 20% 1.46 0.78 U/mg 50 mM Tris-HCl buffer, 2M NaCl 8 40Β°C 1 mM 2-Oxohexanoic acid D-2-hydroxyhexanoic acid 0.3 mM NADH β€” Classical aqueous control (in U/mg)
Activity - Classical Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 20% 2.31 2.02 U/mg 50 mM Tris-HCl buffer, 2M NaCl 8 40Β°C 12.5 mM 2-Oxohexanoic acid D-2-hydroxyhexanoic acid 0.3 mM NADH β€” Classical aqueous control (in U/mg)
Activity - Classical Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 20% 2.28 1.99 U/mg 50 mM Tris-HCl buffer, 2M NaCl 8 40Β°C 10 mM 2-Oxohexanoic acid D-2-hydroxyhexanoic acid 0.3 mM NADH β€” Classical aqueous control (in U/mg)
Activity - Classical Activity measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 20% 2.25 1.96 U/mg 50 mM Tris-HCl buffer, 2M NaCl 8 40Β°C 8 mM 2-Oxohexanoic acid D-2-hydroxyhexanoic acid 0.3 mM NADH β€” Classical aqueous control (in U/mg)
β€Ή Prev
1 2
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*