Esterase (gene Per822) from a paper mill sediment metagenomic library

Enzyme Description

Species
Na (paper mill sediment metagenomic library)
Extremophile
No but "acidophilic" enzyme
EC Number

Sequence

Length: 273 amino acids
MKTLTVKDGTEIYYKDLGAGQPIFFHHGWPLSADDWDAQMMFFLEKGYRVIAHDRRGHGRSTQTYKGNDMDTYAADVAELTAHLNLKNAIHVGHSTGGGEAIRYAAKFGKDRVAKVVLISAITPYMIQDERNPDGVPLAVFDDIRYNTRHNRSQFYQDITVPFFGYNREGADVKKGIQDNWWRQGMMGGIKAQYDCVKVFSETDFTEDLKSVDIPVLVLHGEDDQIVPYATTAVKAHELLKKGTLILYPGFSHGMPTTEAETINNDILKFINS
Bing-Xue Dong et al. (2025) β€” Per822: A pH-stable metagenome-derived perhydrolase for dye decolorization, oil stain removal, and benzo[a]pyrene degradation
International Journal of Biological Macromolecules  Β· doi:10.1016/j.ijbiomac.2025.147131 β†—  Β· Activity + Stability - Incubation
36 measurements
Database ID
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3) pLysS

Experimental Data (36 measurements)

36 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 30% 100.0 122.8 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 30% 100.0 93.2 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 15% 100.0 72.5 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 15% 100.0 63.8 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 30% 100.0 26.1 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 30% 100.0 13.8 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isoamyl Alcohol 15% 100.0 94.9 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 15% 100.0 136.8 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isoamyl Alcohol 30% 100.0 81.5 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isoamyl Alcohol 30% 100.0 73.9 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 15% 100.0 133.1 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 15% 100.0 95.8 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30% 100.0 82.0 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30% 100.0 65.7 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetone 15% 100.0 95.5 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetone 15% 100.0 66.8 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
1 2
Next β€Ί

Visualization : Activity + Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*