Esterase (gene Per822) from a paper mill sediment metagenomic library
Enzyme Description
Species
Na (paper mill sediment metagenomic library)
Extremophile
No
but "acidophilic" enzyme
EC Number
Sequence
MKTLTVKDGTEIYYKDLGAGQPIFFHHGWPLSADDWDAQMMFFLEKGYRVIAHDRRGHGRSTQTYKGNDMDTYAADVAELTAHLNLKNAIHVGHSTGGGEAIRYAAKFGKDRVAKVVLISAITPYMIQDERNPDGVPLAVFDDIRYNTRHNRSQFYQDITVPFFGYNREGADVKKGIQDNWWRQGMMGGIKAQYDCVKVFSETDFTEDLKSVDIPVLVLHGEDDQIVPYATTAVKAHELLKKGTLILYPGFSHGMPTTEAETINNDILKFINS
Bing-Xue Dong et al. (2025)
β Per822: A pH-stable metagenome-derived perhydrolase for dye decolorization, oil stain removal, and benzo[a]pyrene degradation
International Journal of Biological Macromolecules
Β· doi:10.1016/j.ijbiomac.2025.147131 β
Β· Activity + Stability - Incubation
▼
Database ID
UniParc: UPI00129FBA82 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3) pLysS
Experimental Data (36 measurements)
36 measurements β page 2 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity + Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 30% | 100.0 | 122.8 | % | Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 40Β°C | 0.5 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 30% | 100.0 | 93.2 | % | Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 40Β°C | 0.5 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 15% | 100.0 | 72.5 | % | Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 40Β°C | 0.5 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 15% | 100.0 | 63.8 | % | Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 40Β°C | 0.5 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 30% | 100.0 | 26.1 | % | Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 40Β°C | 0.5 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 30% | 100.0 | 13.8 | % | Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 40Β°C | 0.5 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isoamyl Alcohol | 15% | 100.0 | 94.9 | % | Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 40Β°C | 0.5 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 15% | 100.0 | 136.8 | % | Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 40Β°C | 0.5 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isoamyl Alcohol | 30% | 100.0 | 81.5 | % | Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 40Β°C | 0.5 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isoamyl Alcohol | 30% | 100.0 | 73.9 | % | Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 40Β°C | 0.5 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 15% | 100.0 | 133.1 | % | Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 40Β°C | 0.5 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 15% | 100.0 | 95.8 | % | Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 40Β°C | 0.5 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 30% | 100.0 | 82.0 | % | Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 40Β°C | 0.5 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 30% | 100.0 | 65.7 | % | Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 40Β°C | 0.5 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetone | 15% | 100.0 | 95.5 | % | Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 40Β°C | 0.5 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control |
| Activity + Stability - Incubation | Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetone | 15% | 100.0 | 66.8 | % | Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 40Β°C | 0.5 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control |
Visualization : Activity + Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.