Esterase (gene Per822) from a paper mill sediment metagenomic library

Enzyme Description

Species
Na (paper mill sediment metagenomic library)
Extremophile
No but "acidophilic" enzyme
EC Number

Sequence

Length: 273 amino acids
MKTLTVKDGTEIYYKDLGAGQPIFFHHGWPLSADDWDAQMMFFLEKGYRVIAHDRRGHGRSTQTYKGNDMDTYAADVAELTAHLNLKNAIHVGHSTGGGEAIRYAAKFGKDRVAKVVLISAITPYMIQDERNPDGVPLAVFDDIRYNTRHNRSQFYQDITVPFFGYNREGADVKKGIQDNWWRQGMMGGIKAQYDCVKVFSETDFTEDLKSVDIPVLVLHGEDDQIVPYATTAVKAHELLKKGTLILYPGFSHGMPTTEAETINNDILKFINS
Bing-Xue Dong et al. (2025) β€” Per822: A pH-stable metagenome-derived perhydrolase for dye decolorization, oil stain removal, and benzo[a]pyrene degradation
International Journal of Biological Macromolecules  Β· doi:10.1016/j.ijbiomac.2025.147131 β†—  Β· Activity + Stability - Incubation
36 measurements
Database ID
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3) pLysS

Experimental Data (36 measurements)

36 measurements β€” page 1 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 30% 100.0 56.7 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetone 30% 100.0 97.0 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Cyclohexane 15% 100.0 84.3 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Cyclohexane 15% 100.0 53.1 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Cyclohexane 30% 100.0 98.3 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Cyclohexane 30% 100.0 84.8 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 15% 100.0 88.5 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 15% 100.0 84.6 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 30% 100.0 74.2 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetone 30% 100.0 98.9 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 15% 100.0 102.2 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 15% 100.0 93.8 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 30% 100.0 83.2 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 30% 100.0 87.6 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethylformamide (DMF) 15% 100.0 53.9 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethylformamide (DMF) 15% 100.0 41.3 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethylformamide (DMF) 30% 100.0 40.4 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethylformamide (DMF) 30% 100.0 19.4 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isoamyl Alcohol 15% 100.0 125.8 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 15% 100.0 116.3 % Incubation: 50 mM Britton-Robinson buffer, Assay: 50 mM Britton-Robinson buffer Incubation: 8.5, Assay: 8.5 Incubation: 30Β°C, Assay: 40Β°C 0.5 mM p-Nitrophenol acetate Acetic Acid , p-Nitrophenol β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay really was in the presence of organic solvent, uncertainty about control
β€Ή Prev
1 2

Visualization : Activity + Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*