Unspecific peroxygenase (gene HspUPO) from Hypoxylon sp. EC38

Enzyme Description

Species
Hypoxylon sp. EC38 β†—
Extremophile
No
EC Number
1.11.2.1 β†—

Sequence

Length: 261 amino acids
MKSLSFSLALGFGSTLVYSAPSPSSGWQAPGPNDVRAPCPMLNTLANHGFLPHDGKGITVNKTIDALGSALNIDANLSTLLFGFAATTNPQPNATFFDLDHLSRHNILEHDASLSRQDSYFGPADVFNEAVFNQTKSFWTGDIIDVQMAANARIVRLLTSNLTNPEYSLSDLGSAFSIGESAAYIGILGDKKSATVPKSWVEYLFENERLPYELGFKRPNDPFTTDDLGDLSTQIINAQHFPQSPGKVEKRGDTRCPYGYH
Laura Rotilio et al. (2021) β€” Structural and Biochemical Studies Enlighten the Unspecific Peroxygenase from Hypoxylon sp. EC38 as an Efficient Oxidative Biocatalyst
ACS Catalysis  Β· doi:10.1021/acscatal.1c03065 β†—  Β· Activity - Classical
28 measurements ▼
Database ID
UniProt: A0ACD6BA37 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host yeast Pichia pastoris

Experimental Data (28 measurements)

28 measurements β€” page 1 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent Acetonitrile 30% 100 62 % 200 mM sodium citrate buffer 4.5 25Β°C 30 Β΅M ABTS, 2 mM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) ABTS radical cation β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent Acetonitrile 30% 100 1 % 50 mM potassium phosphate buffer 7.4 25Β°C 2 mM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 100 Β΅M Indole Hydroxylated indole derivatives including indigo β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent Acetonitrile 20% 100 16 % 50 mM potassium phosphate buffer 7.4 25Β°C 2 mM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 100 Β΅M Indole Hydroxylated indole derivatives including indigo β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent Acetonitrile 10% 100 40 % 50 mM potassium phosphate buffer 7.4 25Β°C 2 mM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 100 Β΅M Indole Hydroxylated indole derivatives including indigo β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent Acetonitrile 5% 100 100 % 50 mM potassium phosphate buffer 7.4 25Β°C 2 mM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 100 Β΅M Indole Hydroxylated indole derivatives including indigo β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent Acetone 20% 100 12 % 50 mM potassium phosphate buffer 7.4 25Β°C 2 mM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 100 Β΅M Indole Hydroxylated indole derivatives including indigo β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent Acetone 10% 100 32 % 50 mM potassium phosphate buffer 7.4 25Β°C 2 mM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 100 Β΅M Indole Hydroxylated indole derivatives including indigo β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent Acetone 5% 100 100 % 50 mM potassium phosphate buffer 7.4 25Β°C 2 mM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 100 Β΅M Indole Hydroxylated indole derivatives including indigo β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent Acetone 2% 100 100 % 50 mM potassium phosphate buffer 7.4 25Β°C 2 mM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 100 Β΅M Indole Hydroxylated indole derivatives including indigo β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30% 100 0 % 50 mM potassium phosphate buffer 7.4 25Β°C 2 mM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 100 Β΅M Indole Hydroxylated indole derivatives including indigo β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20% 100 5 % 50 mM potassium phosphate buffer 7.4 25Β°C 2 mM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 100 Β΅M Indole Hydroxylated indole derivatives including indigo β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10% 100 12 % 50 mM potassium phosphate buffer 7.4 25Β°C 2 mM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 100 Β΅M Indole Hydroxylated indole derivatives including indigo β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5% 100 92 % 50 mM potassium phosphate buffer 7.4 25Β°C 2 mM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 100 Β΅M Indole Hydroxylated indole derivatives including indigo β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 2% 100 98 % 50 mM potassium phosphate buffer 7.4 25Β°C 2 mM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide), 100 Β΅M Indole Hydroxylated indole derivatives including indigo β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent Dimethyl Sulfoxide (DMSO) 2% 100 100 % 200 mM sodium citrate buffer 4.5 25Β°C 30 Β΅M ABTS, 2 mM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) ABTS radical cation β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent Acetonitrile 20% 100 356 % 200 mM sodium citrate buffer 4.5 25Β°C 30 Β΅M ABTS, 2 mM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) ABTS radical cation β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent Acetonitrile 10% 100 580 % 200 mM sodium citrate buffer 4.5 25Β°C 30 Β΅M ABTS, 2 mM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) ABTS radical cation β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent Acetonitrile 5% 100 470 % 200 mM sodium citrate buffer 4.5 25Β°C 30 Β΅M ABTS, 2 mM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) ABTS radical cation β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent Acetonitrile 2% 100 0 % 200 mM sodium citrate buffer 4.5 25Β°C 30 Β΅M ABTS, 2 mM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) ABTS radical cation β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent Acetone 30% 100 12 % 200 mM sodium citrate buffer 4.5 25Β°C 30 Β΅M ABTS, 2 mM Hβ‚‚Oβ‚‚ (Hydrogen Peroxide) ABTS radical cation β€” β€” Classical aqueous control (in %)
β€Ή Prev
1 2
Next β€Ί

Visualization : Activity β€” Classical

Laura Rotilio et al. (2021)

One bar per measurement. Colour = solvent, shade = solvent volume.

Anica Dadwal et al. (2021) β€” Recombinant cellobiohydrolase of Myceliophthora thermophila: characterization and applicability in cellulose saccharification
AMB Express  Β· doi:10.1186/s13568-021-01311-8 β†—  Β· Activity - Classical
1 measurement ▼

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*