GH39 xylosidase (gene XYL21) from a saline soil sample metagenomic library

Enzyme Description

Species
Na (saline soil sample metagenomic library)
Extremophile
Yes likely halophilic organism (from saline soil) and "halo-tolerant" enzyme
EC Number

Sequence

Length: 501 amino acids
MEKIMISRDNNIPFNKHWKKCIGTGRLGLALQKEYVDHLERLQQDIGFDYIRGHGLFHEDIGIYKEVDVGGTPTPFYNFTYIDRIFDTFLQNNLRPFVELGFMPKKLASGTQTIFYWEGNVTPPAEEKKWEELIYHTVIHFVERYGVEEVLQWPFEVWNEPNLSNFWENADKQAYFQLYKITAKTIKSIHPDLNVGGPAICGGTDEWITDFLHFCHKEQVPVDFISRHAYTSKPPKKKTPDYYYQDLADPNDMLTQLTSVKKLIHDTPYPDLPFHITEYNTSYSPINPIHDTNYNAAYLGKILSHAGDIVSSFSYWTFSDVFEEFDIPRAPFHGGFGLMALHAIRKPTYHLFSFFNKLGDTCLYKDDTMIVTKHRDNTISIVAWNLIHDKGENHDKTITLSIPFSSDDVFLYREITNEHHANPWRVWKQMGRPRFPSKEQITLLKSCDIPFIQTDKLMTENKLLTYQLTMAKNEVTLLHFSDIIDETNTYIGLDDSLLTSY
Zhongyuan Li et al. (2020) β€” Biochemical characterization of a novel halo/organic-solvents/final-products tolerant GH39 xylosidase from saline soil and its synergic action with xylanase
International Journal of Biological Macromolecules  Β· doi:10.1016/j.ijbiomac.2020.07.079 β†—  Β· Activity - Classical
42 measurements
Database ID
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (42 measurements)

42 measurements β€” page 2 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Isoamyl Alcohol 35% 100 97 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Isopropanol 25% 100 9 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Methanol 10% 100 172 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Methanol 15% 100 147 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Methanol 20% 100 81 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Methanol 25% 100 30 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Methanol 30% 100 17 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Methanol 35% 100 15 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Isopropanol 5% 100 178 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Isopropanol 10% 100 166 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Isopropanol 15% 100 77 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Isopropanol 20% 100 17 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Methanol 5% 100 165 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Isopropanol 30% 100 5 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Isopropanol 35% 100 7 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Ethanol 5% 100 175 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Ethanol 10% 100 168 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Ethanol 15% 100 105 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Ethanol 20% 100 30 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Ethanol 25% 100 15 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
1 2 3

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*