GH39 xylosidase (gene XYL21) from a saline soil sample metagenomic library
Enzyme Description
Species
Na (saline soil sample metagenomic library)
Extremophile
Yes
likely halophilic organism (from saline soil) and "halo-tolerant" enzyme
EC Number
Sequence
MEKIMISRDNNIPFNKHWKKCIGTGRLGLALQKEYVDHLERLQQDIGFDYIRGHGLFHEDIGIYKEVDVGGTPTPFYNFTYIDRIFDTFLQNNLRPFVELGFMPKKLASGTQTIFYWEGNVTPPAEEKKWEELIYHTVIHFVERYGVEEVLQWPFEVWNEPNLSNFWENADKQAYFQLYKITAKTIKSIHPDLNVGGPAICGGTDEWITDFLHFCHKEQVPVDFISRHAYTSKPPKKKTPDYYYQDLADPNDMLTQLTSVKKLIHDTPYPDLPFHITEYNTSYSPINPIHDTNYNAAYLGKILSHAGDIVSSFSYWTFSDVFEEFDIPRAPFHGGFGLMALHAIRKPTYHLFSFFNKLGDTCLYKDDTMIVTKHRDNTISIVAWNLIHDKGENHDKTITLSIPFSSDDVFLYREITNEHHANPWRVWKQMGRPRFPSKEQITLLKSCDIPFIQTDKLMTENKLLTYQLTMAKNEVTLLHFSDIIDETNTYIGLDDSLLTSY
Zhongyuan Li et al. (2020)
β Biochemical characterization of a novel halo/organic-solvents/final-products tolerant GH39 xylosidase from saline soil and its synergic action with xylanase
International Journal of Biological Macromolecules
Β· doi:10.1016/j.ijbiomac.2020.07.079 β
Β· Activity - Classical
▼
Database ID
UniParc: UPI00090C2DE3 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (42 measurements)
42 measurements β page 1 of 3
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | 1-Propanol | 25% | 100 | 11 | % | 200 mM citric acidβNaβHPOβ buffer | 5.5 | 45Β°C | 2 mM Ξ²-D-xylopyranoside | D-Xylose , p-Nitrophenol | β | β | Classical aqueous control (in %) | Uncertainty about pH and buffer |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | 1-Butanol | 10% | 100 | 88 | % | 200 mM citric acidβNaβHPOβ buffer | 5.5 | 45Β°C | 2 mM Ξ²-D-xylopyranoside | D-Xylose , p-Nitrophenol | β | β | Classical aqueous control (in %) | Uncertainty about pH and buffer |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | 1-Butanol | 15% | 100 | 76 | % | 200 mM citric acidβNaβHPOβ buffer | 5.5 | 45Β°C | 2 mM Ξ²-D-xylopyranoside | D-Xylose , p-Nitrophenol | β | β | Classical aqueous control (in %) | Uncertainty about pH and buffer |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | 1-Butanol | 20% | 100 | 68 | % | 200 mM citric acidβNaβHPOβ buffer | 5.5 | 45Β°C | 2 mM Ξ²-D-xylopyranoside | D-Xylose , p-Nitrophenol | β | β | Classical aqueous control (in %) | Uncertainty about pH and buffer |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | 1-Butanol | 25% | 100 | 55 | % | 200 mM citric acidβNaβHPOβ buffer | 5.5 | 45Β°C | 2 mM Ξ²-D-xylopyranoside | D-Xylose , p-Nitrophenol | β | β | Classical aqueous control (in %) | Uncertainty about pH and buffer |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | 1-Butanol | 30% | 100 | 45 | % | 200 mM citric acidβNaβHPOβ buffer | 5.5 | 45Β°C | 2 mM Ξ²-D-xylopyranoside | D-Xylose , p-Nitrophenol | β | β | Classical aqueous control (in %) | Uncertainty about pH and buffer |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | 1-Butanol | 35% | 100 | 38 | % | 200 mM citric acidβNaβHPOβ buffer | 5.5 | 45Β°C | 2 mM Ξ²-D-xylopyranoside | D-Xylose , p-Nitrophenol | β | β | Classical aqueous control (in %) | Uncertainty about pH and buffer |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | 1-Propanol | 5% | 100 | 191 | % | 200 mM citric acidβNaβHPOβ buffer | 5.5 | 45Β°C | 2 mM Ξ²-D-xylopyranoside | D-Xylose , p-Nitrophenol | β | β | Classical aqueous control (in %) | Uncertainty about pH and buffer |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | 1-Propanol | 10% | 100 | 48 | % | 200 mM citric acidβNaβHPOβ buffer | 5.5 | 45Β°C | 2 mM Ξ²-D-xylopyranoside | D-Xylose , p-Nitrophenol | β | β | Classical aqueous control (in %) | Uncertainty about pH and buffer |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | 1-Propanol | 15% | 100 | 17 | % | 200 mM citric acidβNaβHPOβ buffer | 5.5 | 45Β°C | 2 mM Ξ²-D-xylopyranoside | D-Xylose , p-Nitrophenol | β | β | Classical aqueous control (in %) | Uncertainty about pH and buffer |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | 1-Propanol | 20% | 100 | 14 | % | 200 mM citric acidβNaβHPOβ buffer | 5.5 | 45Β°C | 2 mM Ξ²-D-xylopyranoside | D-Xylose , p-Nitrophenol | β | β | Classical aqueous control (in %) | Uncertainty about pH and buffer |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | 1-Butanol | 5% | 100 | 112 | % | 200 mM citric acidβNaβHPOβ buffer | 5.5 | 45Β°C | 2 mM Ξ²-D-xylopyranoside | D-Xylose , p-Nitrophenol | β | β | Classical aqueous control (in %) | Uncertainty about pH and buffer |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | 1-Propanol | 30% | 100 | 6 | % | 200 mM citric acidβNaβHPOβ buffer | 5.5 | 45Β°C | 2 mM Ξ²-D-xylopyranoside | D-Xylose , p-Nitrophenol | β | β | Classical aqueous control (in %) | Uncertainty about pH and buffer |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | 1-Propanol | 35% | 100 | 3 | % | 200 mM citric acidβNaβHPOβ buffer | 5.5 | 45Β°C | 2 mM Ξ²-D-xylopyranoside | D-Xylose , p-Nitrophenol | β | β | Classical aqueous control (in %) | Uncertainty about pH and buffer |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | Isoamyl Alcohol | 5% | 100 | 176 | % | 200 mM citric acidβNaβHPOβ buffer | 5.5 | 45Β°C | 2 mM Ξ²-D-xylopyranoside | D-Xylose , p-Nitrophenol | β | β | Classical aqueous control (in %) | Uncertainty about pH and buffer |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | Isoamyl Alcohol | 10% | 100 | 153 | % | 200 mM citric acidβNaβHPOβ buffer | 5.5 | 45Β°C | 2 mM Ξ²-D-xylopyranoside | D-Xylose , p-Nitrophenol | β | β | Classical aqueous control (in %) | Uncertainty about pH and buffer |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | Isoamyl Alcohol | 15% | 100 | 156 | % | 200 mM citric acidβNaβHPOβ buffer | 5.5 | 45Β°C | 2 mM Ξ²-D-xylopyranoside | D-Xylose , p-Nitrophenol | β | β | Classical aqueous control (in %) | Uncertainty about pH and buffer |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | Isoamyl Alcohol | 20% | 100 | 147 | % | 200 mM citric acidβNaβHPOβ buffer | 5.5 | 45Β°C | 2 mM Ξ²-D-xylopyranoside | D-Xylose , p-Nitrophenol | β | β | Classical aqueous control (in %) | Uncertainty about pH and buffer |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | Isoamyl Alcohol | 25% | 100 | 122 | % | 200 mM citric acidβNaβHPOβ buffer | 5.5 | 45Β°C | 2 mM Ξ²-D-xylopyranoside | D-Xylose , p-Nitrophenol | β | β | Classical aqueous control (in %) | Uncertainty about pH and buffer |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent | Isoamyl Alcohol | 30% | 100 | 110 | % | 200 mM citric acidβNaβHPOβ buffer | 5.5 | 45Β°C | 2 mM Ξ²-D-xylopyranoside | D-Xylose , p-Nitrophenol | β | β | Classical aqueous control (in %) | Uncertainty about pH and buffer |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.