GH39 xylosidase (gene XYL21) from a saline soil sample metagenomic library

Enzyme Description

Species
Na (saline soil sample metagenomic library)
Extremophile
Yes likely halophilic organism (from saline soil) and "halo-tolerant" enzyme
EC Number

Sequence

Length: 501 amino acids
MEKIMISRDNNIPFNKHWKKCIGTGRLGLALQKEYVDHLERLQQDIGFDYIRGHGLFHEDIGIYKEVDVGGTPTPFYNFTYIDRIFDTFLQNNLRPFVELGFMPKKLASGTQTIFYWEGNVTPPAEEKKWEELIYHTVIHFVERYGVEEVLQWPFEVWNEPNLSNFWENADKQAYFQLYKITAKTIKSIHPDLNVGGPAICGGTDEWITDFLHFCHKEQVPVDFISRHAYTSKPPKKKTPDYYYQDLADPNDMLTQLTSVKKLIHDTPYPDLPFHITEYNTSYSPINPIHDTNYNAAYLGKILSHAGDIVSSFSYWTFSDVFEEFDIPRAPFHGGFGLMALHAIRKPTYHLFSFFNKLGDTCLYKDDTMIVTKHRDNTISIVAWNLIHDKGENHDKTITLSIPFSSDDVFLYREITNEHHANPWRVWKQMGRPRFPSKEQITLLKSCDIPFIQTDKLMTENKLLTYQLTMAKNEVTLLHFSDIIDETNTYIGLDDSLLTSY
Zhongyuan Li et al. (2020) β€” Biochemical characterization of a novel halo/organic-solvents/final-products tolerant GH39 xylosidase from saline soil and its synergic action with xylanase
International Journal of Biological Macromolecules  Β· doi:10.1016/j.ijbiomac.2020.07.079 β†—  Β· Activity - Classical
42 measurements
Database ID
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (42 measurements)

42 measurements β€” page 1 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent 1-Propanol 25% 100 11 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent 1-Butanol 10% 100 88 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent 1-Butanol 15% 100 76 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent 1-Butanol 20% 100 68 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent 1-Butanol 25% 100 55 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent 1-Butanol 30% 100 45 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent 1-Butanol 35% 100 38 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent 1-Propanol 5% 100 191 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent 1-Propanol 10% 100 48 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent 1-Propanol 15% 100 17 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent 1-Propanol 20% 100 14 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent 1-Butanol 5% 100 112 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent 1-Propanol 30% 100 6 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent 1-Propanol 35% 100 3 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Isoamyl Alcohol 5% 100 176 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Isoamyl Alcohol 10% 100 153 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Isoamyl Alcohol 15% 100 156 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Isoamyl Alcohol 20% 100 147 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Isoamyl Alcohol 25% 100 122 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in the presence of organic solvent Isoamyl Alcohol 30% 100 110 % 200 mM citric acid–Naβ‚‚HPOβ‚„ buffer 5.5 45Β°C 2 mM Ξ²-D-xylopyranoside D-Xylose , p-Nitrophenol β€” β€” Classical aqueous control (in %) | Uncertainty about pH and buffer
β€Ή Prev
1 2 3

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*