Lipase from Pseudomonas cepacia

Enzyme Description

Species

Extremophile

EC Number

3.1.1.3 ↗

Sequence

Length: 364 amino acids

MARTMRSRVVAGAVACAMSIAPFAGTTAVMTLATTHAAMAATAPAAGYAATRYPIILVHGLSGTDKYAGVLEYWYGIQEDLQQNGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLSSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQDVLAYDPTGLSSSVIAAFVNVFGILTSSSHNTNQDALAALQTLTTARAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTLSVFGVTGATDTSTLPLVDPANVLDLSTLALFGTGTVMINRGSGQNDGLVSKCSALYGKVLSTSYKWNHLDEINQLLGVRGAYAEDPVAVIRTHANRLKLAGV

Satish C. Mohapatra et al. (1997) — Lipase kinetics in organic-water solvent with amphipathic substrate for chiral reaction

Biotechnology and Bioengineering · doi:10.1002/(SICI)1097-0290(19970720)55:2%3C399::AID-BIT17%3E3.0.CO;2-C ↗ · Activity - Classical

26 measurements ▼

Database ID

UniProt: P22088 ↗

Sequence Annotation

Inferred

Protein Source

Commercially purchased

Experimental Data (26 measurements)

26 measurements — page 2 of 2

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetone	25%	11.2	34.0	µM/min	0.01 M phosphate buffer	7.1	?	2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate	—	—	Classical aqueous control (in microM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetone	15%	11.2	31.5	µM/min	0.01 M phosphate buffer	7.1	?	2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate	—	—	Classical aqueous control (in microM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Tetrahydrofuran (THF)	25%	11.2	19.0	µM/min	0.01 M phosphate buffer	7.1	?	2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate	—	—	Classical aqueous control (in microM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetone	25%	11.2	31.7	µM/min	0.01 M phosphate buffer	7.1	?	2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate	—	—	Classical aqueous control (in microM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetonitrile	25%	11.2	22.16	µM/min	0.01 M phosphate buffer	7.1	?	2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate	—	—	Classical aqueous control (in microM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Dimethylformamide (DMF)	25%	11.2	79.17	µM/min	0.01 M phosphate buffer	7.1	?	2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate	—	—	Classical aqueous control (in microM/min)

Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetone	100%	11.2	0.0	µM/min	0.01 M phosphate buffer	7.1	?	2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetone	100%	35.3	0.4	µM/min	0.01 M phosphate buffer	7.1	?	18 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetone	75%	35.3	9.1	µM/min	0.01 M phosphate buffer	7.1	?	18 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetone	50%	35.3	37.0	µM/min	0.01 M phosphate buffer	7.1	?	18 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetone	35%	35.3	56.8	µM/min	0.01 M phosphate buffer	7.1	?	18 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetone	25%	35.3	71.3	µM/min	0.01 M phosphate buffer	7.1	?	18 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetone	15%	35.3	63.5	µM/min	0.01 M phosphate buffer	7.1	?	18 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetone	100%	15.8	0.0	µM/min	0.01 M phosphate buffer	7.1	?	9 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetone	75%	15.8	1.2	µM/min	0.01 M phosphate buffer	7.1	?	9 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetone	50%	15.8	17.4	µM/min	0.01 M phosphate buffer	7.1	?	9 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetone	35%	15.8	49.0	µM/min	0.01 M phosphate buffer	7.1	?	9 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetone	25%	15.8	55.6	µM/min	0.01 M phosphate buffer	7.1	?	9 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetone	15%	15.8	49.0	µM/min	0.01 M phosphate buffer	7.1	?	9 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by HPLC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	25%	11.2	82.3	µM/min	0.01 M phosphate buffer	7.1	?	2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetone	75%	11.2	0.0	µM/min	0.01 M phosphate buffer	7.1	?	2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetone	50%	11.2	0.0	µM/min	0.01 M phosphate buffer	7.1	?	2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetone	45%	11.2	0.0	µM/min	0.01 M phosphate buffer	7.1	?	2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetone	40%	11.2	24.5	µM/min	0.01 M phosphate buffer	7.1	?	2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetone	35%	11.2	30.7	µM/min	0.01 M phosphate buffer	7.1	?	2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetone	30%	11.2	31.1	µM/min	0.01 M phosphate buffer	7.1	?	2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetone	25%	11.2	34.0	µM/min	0.01 M phosphate buffer	7.1	?	2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetone	15%	11.2	31.5	µM/min	0.01 M phosphate buffer	7.1	?	2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Tetrahydrofuran (THF)	25%	11.2	19.0	µM/min	0.01 M phosphate buffer	7.1	?	2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetone	25%	11.2	31.7	µM/min	0.01 M phosphate buffer	7.1	?	2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Acetonitrile	25%	11.2	22.16	µM/min	0.01 M phosphate buffer	7.1	?	2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)
Activity - Classical	Initial reaction rate (in µM/min) measured by chromatography	Dimethylformamide (DMF)	25%	11.2	79.17	µM/min	0.01 M phosphate buffer	7.1	?	2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane	1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane, Acetate	—	—	Classical aqueous control (in µM/min)

‹ Prev

1 2

Next ›

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*