Lipase from Pseudomonas cepacia
Enzyme Description
Sequence
MARTMRSRVVAGAVACAMSIAPFAGTTAVMTLATTHAAMAATAPAAGYAATRYPIILVHGLSGTDKYAGVLEYWYGIQEDLQQNGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLSSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQDVLAYDPTGLSSSVIAAFVNVFGILTSSSHNTNQDALAALQTLTTARAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTLSVFGVTGATDTSTLPLVDPANVLDLSTLALFGTGTVMINRGSGQNDGLVSKCSALYGKVLSTSYKWNHLDEINQLLGVRGAYAEDPVAVIRTHANRLKLAGV
Satish C. Mohapatra et al. (1997)
β Lipase kinetics in organic-water solvent with amphipathic substrate for chiral reaction
Biotechnology and Bioengineering
Β· doi:10.1002/(SICI)1097-0290(19970720)55:2%3C399::AID-BIT17%3E3.0.CO;2-C β
Β· Activity - Classical
▼
Experimental Data (26 measurements)
26 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Initial reaction rate (in Β΅M/min) measured by chromatography | Acetone | 100% | 11.2 | 0.0 | Β΅M/min | 0.01 M phosphate buffer | 7.1 | ? | 2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane | 1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate | β | β | Classical aqueous control (in microM/min) |
| Activity - Classical | Initial reaction rate (in Β΅M/min) measured by chromatography | Acetone | 100% | 35.3 | 0.4 | Β΅M/min | 0.01 M phosphate buffer | 7.1 | ? | 18 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane | 1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate | β | β | Classical aqueous control (in microM/min) |
| Activity - Classical | Initial reaction rate (in Β΅M/min) measured by chromatography | Acetone | 75% | 35.3 | 9.1 | Β΅M/min | 0.01 M phosphate buffer | 7.1 | ? | 18 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane | 1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate | β | β | Classical aqueous control (in microM/min) |
| Activity - Classical | Initial reaction rate (in Β΅M/min) measured by chromatography | Acetone | 50% | 35.3 | 37.0 | Β΅M/min | 0.01 M phosphate buffer | 7.1 | ? | 18 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane | 1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate | β | β | Classical aqueous control (in microM/min) |
| Activity - Classical | Initial reaction rate (in Β΅M/min) measured by chromatography | Acetone | 35% | 35.3 | 56.8 | Β΅M/min | 0.01 M phosphate buffer | 7.1 | ? | 18 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane | 1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate | β | β | Classical aqueous control (in microM/min) |
| Activity - Classical | Initial reaction rate (in Β΅M/min) measured by chromatography | Acetone | 25% | 35.3 | 71.3 | Β΅M/min | 0.01 M phosphate buffer | 7.1 | ? | 18 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane | 1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate | β | β | Classical aqueous control (in microM/min) |
| Activity - Classical | Initial reaction rate (in Β΅M/min) measured by chromatography | Acetone | 15% | 35.3 | 63.5 | Β΅M/min | 0.01 M phosphate buffer | 7.1 | ? | 18 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane | 1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate | β | β | Classical aqueous control (in microM/min) |
| Activity - Classical | Initial reaction rate (in Β΅M/min) measured by chromatography | Acetone | 100% | 15.8 | 0.0 | Β΅M/min | 0.01 M phosphate buffer | 7.1 | ? | 9 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane | 1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate | β | β | Classical aqueous control (in microM/min) |
| Activity - Classical | Initial reaction rate (in Β΅M/min) measured by chromatography | Acetone | 75% | 15.8 | 1.2 | Β΅M/min | 0.01 M phosphate buffer | 7.1 | ? | 9 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane | 1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate | β | β | Classical aqueous control (in microM/min) |
| Activity - Classical | Initial reaction rate (in Β΅M/min) measured by chromatography | Acetone | 50% | 15.8 | 17.4 | Β΅M/min | 0.01 M phosphate buffer | 7.1 | ? | 9 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane | 1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate | β | β | Classical aqueous control (in microM/min) |
| Activity - Classical | Initial reaction rate (in Β΅M/min) measured by chromatography | Acetone | 35% | 15.8 | 49.0 | Β΅M/min | 0.01 M phosphate buffer | 7.1 | ? | 9 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane | 1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate | β | β | Classical aqueous control (in microM/min) |
| Activity - Classical | Initial reaction rate (in Β΅M/min) measured by chromatography | Acetone | 25% | 15.8 | 55.6 | Β΅M/min | 0.01 M phosphate buffer | 7.1 | ? | 9 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane | 1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate | β | β | Classical aqueous control (in microM/min) |
| Activity - Classical | Initial reaction rate (in Β΅M/min) measured by chromatography | Acetone | 15% | 15.8 | 49.0 | Β΅M/min | 0.01 M phosphate buffer | 7.1 | ? | 9 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane | 1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate | β | β | Classical aqueous control (in microM/min) |
| Activity - Classical | Initial reaction rate (in Β΅M/min) measured by HPLC in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 25% | 11.2 | 82.3 | Β΅M/min | 0.01 M phosphate buffer | 7.1 | ? | 2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane | 1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate | β | β | Classical aqueous control (in microM/min) |
| Activity - Classical | Initial reaction rate (in Β΅M/min) measured by chromatography | Acetone | 75% | 11.2 | 0.0 | Β΅M/min | 0.01 M phosphate buffer | 7.1 | ? | 2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane | 1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate | β | β | Classical aqueous control (in microM/min) |
| Activity - Classical | Initial reaction rate (in Β΅M/min) measured by chromatography | Acetone | 50% | 11.2 | 0.0 | Β΅M/min | 0.01 M phosphate buffer | 7.1 | ? | 2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane | 1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate | β | β | Classical aqueous control (in microM/min) |
| Activity - Classical | Initial reaction rate (in Β΅M/min) measured by chromatography | Acetone | 45% | 11.2 | 0.0 | Β΅M/min | 0.01 M phosphate buffer | 7.1 | ? | 2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane | 1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate | β | β | Classical aqueous control (in microM/min) |
| Activity - Classical | Initial reaction rate (in Β΅M/min) measured by chromatography | Acetone | 40% | 11.2 | 24.5 | Β΅M/min | 0.01 M phosphate buffer | 7.1 | ? | 2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane | 1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate | β | β | Classical aqueous control (in microM/min) |
| Activity - Classical | Initial reaction rate (in Β΅M/min) measured by chromatography | Acetone | 35% | 11.2 | 30.7 | Β΅M/min | 0.01 M phosphate buffer | 7.1 | ? | 2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane | 1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate | β | β | Classical aqueous control (in microM/min) |
| Activity - Classical | Initial reaction rate (in Β΅M/min) measured by chromatography | Acetone | 30% | 11.2 | 31.1 | Β΅M/min | 0.01 M phosphate buffer | 7.1 | ? | 2.5 mM 1-chloro-2-acetoxy-3-(1-naphthyloxy)-propane | 1-chloro-2-hydroxy-3-(1-naphthyloxy)-propane , Acetate | β | β | Classical aqueous control (in microM/min) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.