Esterase (gene EstSP) from a Goa solar saltern metagenomic library

Enzyme Description

Species
Na (Goa solar saltern metagenomic library)
Extremophile
Yes probably halophilic organism (solar saltern), halotolerant enzyme
EC Number
3.1.1.1 β†—

Sequence

Length: 337 amino acids
MLGGLEQPMLHQIADVDSREEALAIANSESALAEEAALIELMQAMDDESVHSSAGLVISEHHINSEPDNNSINVRVIRPDTDAVLPCILYLHGGAMMSMSYDLGTYRAWGKVLAQQGICVAMVDFRNSLRPSTTEEVAPFPAGLNDCVSGYHWVRTNASALKIDPESVLIAGDSGGGNLAIATTMRLVDAGQPPLGLYALCPYILGQWPNADYPSSEEFEGYLISVHNNHATMAYGIEAFERRDRYAWPGFATAENLQGFPPSMISVNECDPLRDEGIAFYRKLLEAGVQAHCRQLMGTVHANEMFTTVFPELTRMTARDMVGWVRECQLLTGSAPA
G. Jayanath et al. (2018) β€” A novel solvent tolerant esterase of GDSGG motif subfamily from solar saltern through metagenomic approach: Recombinant expression and characterization
International Journal of Biological Macromolecules  Β· doi:10.1016/j.ijbiomac.2018.06.057 β†—  Β· Stability - Incubation
64 measurements ▼
Database ID
UniParc: UPI000B54DD3F β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli Rosetta-gami B(DE3) pLysS

Experimental Data (64 measurements)

64 measurements β€” page 3 of 4
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Xylene 10% 100.0 136.98 % Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Xylene 20% 100.0 99.78 % Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 10% 100.0 121.84 % Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 20% 100.0 99.36 % Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethylformamide (DMF) 10% 100.0 111.94 % Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethylformamide (DMF) 20% 100.0 76.24 % Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase n-Hexane 10% 100.0 134.29 % Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase n-Hexane 20% 100.0 113.81 % Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetone 10% 100.0 141.76 % Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetone 20% 100.0 100.0 % Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 10% 100.0 117.0 % Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 20% 100.0 105.67 % Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 10% 100.0 113.0 % Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 20% 100.0 67.17 % Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase 1-Butanol 10% 100.0 144.39 % Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase 1-Butanol 20% 100.0 117.19 % Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Xylene 10% 100.0 108.66 % Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Xylene 20% 100.0 89.16 % Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 10% 100.0 28.1 % Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 20% 100.0 0.0 % Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
β€Ή Prev
1 2 3 4
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*