Esterase (gene EstSP) from a Goa solar saltern metagenomic library

Enzyme Description

Species

Na (Goa solar saltern metagenomic library)

Extremophile

Yes probably halophilic organism (solar saltern), halotolerant enzyme

EC Number

3.1.1.1 ↗

Sequence

Length: 337 amino acids

MLGGLEQPMLHQIADVDSREEALAIANSESALAEEAALIELMQAMDDESVHSSAGLVISEHHINSEPDNNSINVRVIRPDTDAVLPCILYLHGGAMMSMSYDLGTYRAWGKVLAQQGICVAMVDFRNSLRPSTTEEVAPFPAGLNDCVSGYHWVRTNASALKIDPESVLIAGDSGGGNLAIATTMRLVDAGQPPLGLYALCPYILGQWPNADYPSSEEFEGYLISVHNNHATMAYGIEAFERRDRYAWPGFATAENLQGFPPSMISVNECDPLRDEGIAFYRKLLEAGVQAHCRQLMGTVHANEMFTTVFPELTRMTARDMVGWVRECQLLTGSAPA

G. Jayanath et al. (2018) — A novel solvent tolerant esterase of GDSGG motif subfamily from solar saltern through metagenomic approach: Recombinant expression and characterization

International Journal of Biological Macromolecules · doi:10.1016/j.ijbiomac.2018.06.057 ↗ · Stability - Incubation

64 measurements ▼

Database ID

UniParc: UPI000B54DD3F ↗

Sequence Annotation

Explicit - Provided GenBank Accession Number

Protein Source

Recombinant, host bacterium Escherichia coli Rosetta-gami B(DE3) pLysS

Experimental Data (64 measurements)

64 measurements — page 2 of 4

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	10%	100.0	93.66	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	20%	100.0	44.89	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	1-Butanol	10%	100.0	129.83	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	1-Butanol	20%	100.0	121.96	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Xylene	10%	100.0	84.26	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Xylene	20%	100.0	41.6	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	10%	100.0	0.0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	20%	100.0	0.0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethylformamide (DMF)	10%	100.0	20.86	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethylformamide (DMF)	20%	100.0	8.43	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	n-Hexane	10%	100.0	83.29	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	n-Hexane	20%	100.0	45.97	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetone	10%	100.0	125.51	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetone	20%	100.0	126.93	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	10%	100.0	145.09	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	20%	100.0	126.54	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	10%	100.0	114.07	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	20%	100.0	102.2	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	1-Butanol	10%	100.0	145.98	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	1-Butanol	20%	100.0	135.73	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase

Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetone	10%	100.0	107.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (48 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetone	20%	100.0	111.63	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (48 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	10%	100.0	130.58	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (48 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	20%	100.0	104.51	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (48 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	10%	100.0	75.9	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (48 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	20%	100.0	56.24	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (48 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	1-Butanol	10%	100.0	128.57	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (48 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	1-Butanol	20%	100.0	126.96	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (48 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Xylene	10%	100.0	91.98	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (48 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Xylene	20%	100.0	79.47	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (48 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	10%	100.0	0.0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (48 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	20%	100.0	0.0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (48 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethylformamide (DMF)	10%	100.0	21.48	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (48 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethylformamide (DMF)	20%	100.0	9.07	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (48 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	n-Hexane	10%	100.0	91.72	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (48 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	n-Hexane	20%	100.0	76.56	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (48 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetone	10%	100.0	120.69	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetone	20%	100.0	84.14	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	10%	100.0	100.64	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	20%	100.0	93.97	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	10%	100.0	93.66	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	20%	100.0	44.89	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	1-Butanol	10%	100.0	129.83	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	1-Butanol	20%	100.0	121.96	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Xylene	10%	100.0	84.26	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Xylene	20%	100.0	41.6	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	10%	100.0	0.0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	20%	100.0	0.0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethylformamide (DMF)	10%	100.0	20.86	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethylformamide (DMF)	20%	100.0	8.43	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	n-Hexane	10%	100.0	83.29	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (72 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	n-Hexane	20%	100.0	45.97	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetone	10%	100.0	125.51	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetone	20%	100.0	126.93	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	10%	100.0	145.09	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	20%	100.0	126.54	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	10%	100.0	114.07	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	20%	100.0	102.2	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	1-Butanol	10%	100.0	145.98	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	1-Butanol	20%	100.0	135.73	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Xylene	10%	100.0	136.98	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Xylene	20%	100.0	99.78	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	10%	100.0	121.84	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	20%	100.0	99.36	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethylformamide (DMF)	10%	100.0	111.94	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethylformamide (DMF)	20%	100.0	76.24	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	n-Hexane	10%	100.0	134.29	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	n-Hexane	20%	100.0	113.81	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetone	10%	100.0	141.76	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetone	20%	100.0	100.0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	10%	100.0	117.0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	20%	100.0	105.67	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	10%	100.0	113.0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	20%	100.0	67.17	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	1-Butanol	10%	100.0	144.39	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	1-Butanol	20%	100.0	117.19	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Xylene	10%	100.0	108.66	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Xylene	20%	100.0	89.16	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	10%	100.0	28.1	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	20%	100.0	0.0	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethylformamide (DMF)	10%	100.0	48.32	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethylformamide (DMF)	20%	100.0	28.52	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	n-Hexane	10%	100.0	112.33	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	n-Hexane	20%	100.0	82.98	%	Incubation: ?, Assay: 50 mM Tris-HCl buffer	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 40°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase

‹ Prev

1 2 3 4

Next ›

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*