Lipase (gene Lip98) from Aeromicrobium sp. SCSIO 25071

Enzyme Description

Species

Extremophile

EC Number

3.1.1.3 ↗

Sequence

Length: 322 amino acids

MRTPRVLGTVLAAAALAVGLVAAPAQAEAPKPPLPVTYSFLLPAVIAGLGIDADPPGANDWSCQPSAAHPNPVVLVHGLTGSKATNWQTYAPLLANEGYCVYALTYGQVKNIVSPPYDQVFGGFGPIEESAAQLSTFVDRVLASTGAAKVDIVGHSEGTLMPNYYAKFLDGAPKIDKYVSIAPLWHGTDPAGLATLSLIGTPFGVTPVINAALQPFFASGPQLLAGSPFIEKMRSGGGPAVPGITYTNIVTRLDELVIPYTSGIEPGMTNHVVQDYCGLDLSEHFQIVADPVAAALVLNALDPAHPRPVPCQLVLPFVGNIL

Hongfei Su et al. (2016) — Cloning, Expression, and Characterization of a Cold-Active and Organic Solvent-Tolerant Lipase from Aeromicrobium sp. SCSIO 25071

Journal of Microbiology and Biotechnology · doi:10.4014/jmb.1511.11068 ↗ · Stability - Incubation

48 measurements ▼

Database ID

UniProt: A0A0S1U326 ↗

Sequence Annotation

Explicit - Provided

Protein Source

Recombinant, host bacterium Escherichia coli Rosetta (DE3)

Experimental Data (48 measurements)

48 measurements — page 3 of 3

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	1-Hexanol	50%	100.0	37.0	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	1-Hexanol	100%	100.0	0.0	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Toluene	30%	100.0	87.3	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Toluene	50%	100.0	122.0	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Toluene	100%	100.0	0.0	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	n-Hexane	30%	100.0	127.2	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	n-Hexane	50%	100.0	147.4	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	n-Hexane	100%	100.0	108.8	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase

Stability - Incubation	Activity after incubation (12 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	tert-Butanol	30%	100.0	78.2	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Ethanol	50%	100.0	55.8	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Ethanol	100%	100.0	33.8	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Acetone	30%	100.0	142.9	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Acetone	50%	100.0	74.4	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Acetone	100%	100.0	122.0	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Acetonitrile	30%	100.0	80.1	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Acetonitrile	50%	100.0	37.6	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Acetonitrile	100%	100.0	70.5	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	30%	100.0	103.7	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	50%	100.0	98.7	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	100%	100.0	97.6	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Ethanol	30%	100.0	113.4	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	tert-Butanol	50%	100.0	43.8	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	tert-Butanol	100%	100.0	0.0	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	1-Hexanol	30%	100.0	64.7	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	1-Hexanol	50%	100.0	55.6	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	1-Hexanol	100%	100.0	0.0	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Toluene	30%	100.0	105.0	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Toluene	50%	100.0	117.3	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Toluene	100%	100.0	0.0	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	n-Hexane	30%	100.0	149.9	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	n-Hexane	50%	100.0	119.6	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	n-Hexane	100%	100.0	107.9	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	tert-Butanol	30%	100.0	127.0	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Ethanol	50%	100.0	49.0	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Ethanol	100%	100.0	40.0	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Acetone	30%	100.0	166.5	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Acetone	50%	100.0	73.6	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Acetone	100%	100.0	76.3	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Acetonitrile	30%	100.0	85.2	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Acetonitrile	50%	100.0	47.6	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Acetonitrile	100%	100.0	73.3	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	30%	100.0	151.0	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	50%	100.0	83.3	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	100%	100.0	78.8	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Ethanol	30%	100.0	139.0	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	tert-Butanol	50%	100.0	47.7	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	tert-Butanol	100%	100.0	0.0	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	1-Hexanol	30%	100.0	81.0	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	1-Hexanol	50%	100.0	37.0	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	1-Hexanol	100%	100.0	0.0	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Toluene	30%	100.0	87.3	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Toluene	50%	100.0	122.0	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	Toluene	100%	100.0	0.0	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	n-Hexane	30%	100.0	127.2	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	n-Hexane	50%	100.0	147.4	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at 25°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase	n-Hexane	100%	100.0	108.8	%	Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol	Incubation: ?, Assay: 8	Incubation: 25°C, Assay: 25°C	1 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase

‹ Prev

1 2 3

Next ›

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*