Lipase (gene Lip98) from Aeromicrobium sp. SCSIO 25071

Enzyme Description

Species
Aeromicrobium sp. SCSIO 25071 β†—
Extremophile
No
EC Number
3.1.1.3 β†—

Sequence

Length: 322 amino acids
MRTPRVLGTVLAAAALAVGLVAAPAQAEAPKPPLPVTYSFLLPAVIAGLGIDADPPGANDWSCQPSAAHPNPVVLVHGLTGSKATNWQTYAPLLANEGYCVYALTYGQVKNIVSPPYDQVFGGFGPIEESAAQLSTFVDRVLASTGAAKVDIVGHSEGTLMPNYYAKFLDGAPKIDKYVSIAPLWHGTDPAGLATLSLIGTPFGVTPVINAALQPFFASGPQLLAGSPFIEKMRSGGGPAVPGITYTNIVTRLDELVIPYTSGIEPGMTNHVVQDYCGLDLSEHFQIVADPVAAALVLNALDPAHPRPVPCQLVLPFVGNIL
Hongfei Su et al. (2016) β€” Cloning, Expression, and Characterization of a Cold-Active and Organic Solvent-Tolerant Lipase from Aeromicrobium sp. SCSIO 25071
Journal of Microbiology and Biotechnology  Β· doi:10.4014/jmb.1511.11068 β†—  Β· Stability - Incubation
48 measurements ▼
Database ID
UniProt: A0A0S1U326 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli Rosetta (DE3)

Experimental Data (48 measurements)

48 measurements β€” page 1 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (12 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase tert-Butanol 30% 100.0 78.2 % Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethanol 50% 100.0 55.8 % Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethanol 100% 100.0 33.8 % Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Acetone 30% 100.0 142.9 % Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Acetone 50% 100.0 74.4 % Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Acetone 100% 100.0 122.0 % Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Acetonitrile 30% 100.0 80.1 % Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Acetonitrile 50% 100.0 37.6 % Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Acetonitrile 100% 100.0 70.5 % Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 30% 100.0 103.7 % Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 50% 100.0 98.7 % Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 100% 100.0 97.6 % Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethanol 30% 100.0 113.4 % Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase tert-Butanol 50% 100.0 43.8 % Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase tert-Butanol 100% 100.0 0.0 % Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase 1-Hexanol 30% 100.0 64.7 % Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase 1-Hexanol 50% 100.0 55.6 % Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase 1-Hexanol 100% 100.0 0.0 % Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Toluene 30% 100.0 105.0 % Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Toluene 50% 100.0 117.3 % Incubation: ?, Assay: 50 mM Tris-base, 0.4% Triton X-100, 0.1% gum arabic, 10% isopropanol Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
β€Ή Prev
1 2 3
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*