Lipase (gene lipW) from Bacillus subtilis

Enzyme Description

Species

Extremophile

EC Number

3.1.1.3 ↗

Sequence

Length: 210 amino acids

MKKVLMAFIICLSLILSVLAAPPSGAKAESVHNPVVLVHGISGASYNFFAIKNYLISQGWQSNKLYAIDFYDKTGNNLNNGPQLASYVDRVLKETGAKKVDIVAHSMGGANTLYYIKYLGGGNKIQNVVTLGGANGLVSSTALPGTDPNQKILYTSIYSLNDQIVINSLSRLQGARNIQLYGIGHIGLLSNSQVNGYIKEGLNGGGLNTN

Jyoti Khurana et al. (2015) — New Insight into Old Bacillus Lipase: Solvent Stable Mesophilic Lipase Demonstrating Enzyme Activity towards Cold

Microbial Physiology · doi:10.1159/000439276 ↗ · Stability - Incubation

28 measurements ▼

Database ID

UniProt: B8YLY0 ↗

Sequence Annotation

Explicit - Provided GenBank Accession Number

Protein Source

Recombinant, host bacterium Escherichia coli JM109

Experimental Data (28 measurements)

28 measurements — page 2 of 2

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Incubation	Activity after incubation (2 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	Tetrahydrofuran (THF)	50%	100	98	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (2 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	n-Heptane	80%	100	91	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (2 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	n-Heptane	50%	100	100	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (2 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	Toluene	80%	100	82	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (2 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	Toluene	50%	100	100	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (2 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	Benzene	80%	100	97	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (2 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	Benzene	50%	100	110	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (2 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	n-Hexane	80%	100	151	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase

Stability - Incubation	Activity after incubation (24 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	n-Hexane	50%	100	225	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	Isopropanol	80%	100	58	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	Isopropanol	50%	100	98	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	80%	100	18	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	50%	100	50	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	Tetrahydrofuran (THF)	80%	100	89	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	Tetrahydrofuran (THF)	50%	100	98	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	n-Heptane	80%	100	87	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	n-Heptane	50%	100	96	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	Toluene	80%	100	44	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	Toluene	50%	100	60	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	Benzene	80%	100	154	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	Benzene	50%	100	190	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (24 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	n-Hexane	80%	100	187	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (2 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	n-Hexane	50%	100	160	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (2 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	Isopropanol	80%	100	66	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (2 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	Isopropanol	50%	100	100	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (2 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	80%	100	31	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (2 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	50%	100	80	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (2 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	Tetrahydrofuran (THF)	80%	100	104	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (2 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	Tetrahydrofuran (THF)	50%	100	98	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (2 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	n-Heptane	80%	100	91	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (2 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	n-Heptane	50%	100	100	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (2 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	Toluene	80%	100	82	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (2 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	Toluene	50%	100	100	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (2 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	Benzene	80%	100	97	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (2 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	Benzene	50%	100	110	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (2 hours at ?°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase	n-Hexane	80%	100	151	%	Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate	Incubation: ?, Assay: 8	Incubation: ?, Assay: 37°C	0.2 mM p-Nitrophenyl laurate	Lauric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase

‹ Prev

1 2

Next ›

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*