Lipase (gene lipW) from Bacillus subtilis

Enzyme Description

Species
Bacillus subtilis β†—
Extremophile
No
EC Number
3.1.1.3 β†—

Sequence

Length: 210 amino acids
MKKVLMAFIICLSLILSVLAAPPSGAKAESVHNPVVLVHGISGASYNFFAIKNYLISQGWQSNKLYAIDFYDKTGNNLNNGPQLASYVDRVLKETGAKKVDIVAHSMGGANTLYYIKYLGGGNKIQNVVTLGGANGLVSSTALPGTDPNQKILYTSIYSLNDQIVINSLSRLQGARNIQLYGIGHIGLLSNSQVNGYIKEGLNGGGLNTN
Jyoti Khurana et al. (2015) β€” New Insight into Old Bacillus Lipase: Solvent Stable Mesophilic Lipase Demonstrating Enzyme Activity towards Cold
Microbial Physiology  Β· doi:10.1159/000439276 β†—  Β· Stability - Incubation
28 measurements ▼
Database ID
UniProt: B8YLY0 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli JM109

Experimental Data (28 measurements)

28 measurements β€” page 1 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (24 hours at ?Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase n-Hexane 50% 100 225 % Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate Incubation: ?, Assay: 8 Incubation: ?, Assay: 37Β°C 0.2 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at ?Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase Isopropanol 80% 100 58 % Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate Incubation: ?, Assay: 8 Incubation: ?, Assay: 37Β°C 0.2 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at ?Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase Isopropanol 50% 100 98 % Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate Incubation: ?, Assay: 8 Incubation: ?, Assay: 37Β°C 0.2 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at ?Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 80% 100 18 % Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate Incubation: ?, Assay: 8 Incubation: ?, Assay: 37Β°C 0.2 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at ?Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 50% 100 50 % Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate Incubation: ?, Assay: 8 Incubation: ?, Assay: 37Β°C 0.2 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at ?Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase Tetrahydrofuran (THF) 80% 100 89 % Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate Incubation: ?, Assay: 8 Incubation: ?, Assay: 37Β°C 0.2 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at ?Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase Tetrahydrofuran (THF) 50% 100 98 % Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate Incubation: ?, Assay: 8 Incubation: ?, Assay: 37Β°C 0.2 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at ?Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase n-Heptane 80% 100 87 % Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate Incubation: ?, Assay: 8 Incubation: ?, Assay: 37Β°C 0.2 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at ?Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase n-Heptane 50% 100 96 % Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate Incubation: ?, Assay: 8 Incubation: ?, Assay: 37Β°C 0.2 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at ?Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase Toluene 80% 100 44 % Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate Incubation: ?, Assay: 8 Incubation: ?, Assay: 37Β°C 0.2 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at ?Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase Toluene 50% 100 60 % Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate Incubation: ?, Assay: 8 Incubation: ?, Assay: 37Β°C 0.2 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at ?Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase Benzene 80% 100 154 % Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate Incubation: ?, Assay: 8 Incubation: ?, Assay: 37Β°C 0.2 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at ?Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase Benzene 50% 100 190 % Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate Incubation: ?, Assay: 8 Incubation: ?, Assay: 37Β°C 0.2 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at ?Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase n-Hexane 80% 100 187 % Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate Incubation: ?, Assay: 8 Incubation: ?, Assay: 37Β°C 0.2 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (2 hours at ?Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase n-Hexane 50% 100 160 % Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate Incubation: ?, Assay: 8 Incubation: ?, Assay: 37Β°C 0.2 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (2 hours at ?Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase Isopropanol 80% 100 66 % Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate Incubation: ?, Assay: 8 Incubation: ?, Assay: 37Β°C 0.2 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (2 hours at ?Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase Isopropanol 50% 100 100 % Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate Incubation: ?, Assay: 8 Incubation: ?, Assay: 37Β°C 0.2 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (2 hours at ?Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 80% 100 31 % Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate Incubation: ?, Assay: 8 Incubation: ?, Assay: 37Β°C 0.2 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (2 hours at ?Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 50% 100 80 % Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate Incubation: ?, Assay: 8 Incubation: ?, Assay: 37Β°C 0.2 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (2 hours at ?Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 420 nm) in aqueous phase Tetrahydrofuran (THF) 80% 100 104 % Incubation: ?, Assay: 40 mM phosphate buffer, 2 mM sodium deoxycholate Incubation: ?, Assay: 8 Incubation: ?, Assay: 37Β°C 0.2 mM p-Nitrophenyl laurate Lauric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
β€Ή Prev
1 2
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*