Esterase (gene Est-gela) from Bacillus gelatini KACC 12197

Enzyme Description

Species

Bacillus gelatini KACC 12197 ↗

Extremophile

No but "thermostable" enzyme

EC Number

3.1.1.- ↗

Sequence

Length: 389 amino acids

MPDLLTNVAENYVNQDLFAGIEWRIDQDGKPIFQGCAGVKDIETRTFIPKNAIYRIYSMTKPIVSFLAMMLIERGVFRLSSPIQNFDPRFKSMKVIDQHAHIEPATALITIEHLLTHQAGFSYDFSLGCPISAHYRDAQLIEDGGRDLTDMMGVLAELPLVFHPGTQWKYSISTDVLAHIIECATGERVDDLLQRLIFDPLDMQDTGFSLPLDGASRLMEVYGMRSLHGLPALKPAPHVLVPADLGSSHPTDDPDFRRGGHGLYSTLDDYMAFANMLLSGQTPEGETLLSPAMLKLALAPRVYFGAGGMRINDEPFAGYSWNLLGRVMTDVGAAAYATHLGEFGWSGAAATYFWVDPTKNMTGCVMTQFLGSQHPIGSDMQAAAMSMLG

Jinyeong Kim et al. (2015) — Cloning and characterization of a novel thermostable esterase from Bacillus gelatini KACC 12197

Protein Expression and Purification · doi:10.1016/j.pep.2015.08.009 ↗ · Activity - Classical Specificity - Enantioselectivity

48 measurements ▼

Database ID

UniParc: UPI001D542755 ↗

Sequence Annotation

Explicit - Provided

Protein Source

Recombinant, host bacterium Escherichia coli XL1-blue

Experimental Data (48 measurements)

48 measurements — page 2 of 3

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Ethanol	10%	100.0	40.1	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid) , alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Isopropanol	5%	100.0	119.5	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid) , alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Isopropanol	10%	100.0	45.5	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid) , alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	100.0	132.8	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid) , alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100.0	118.6	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid) , alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	1-Butanol	5%	100.0	0.0	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid) , alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	1-Butanol	10%	100.0	0.0	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid) , alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	1-Propanol	5%	100.0	11.2	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid) , alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	1-Propanol	10%	100.0	0.0	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid) , alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	n-Hexane	5%	100.0	125.7	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid) , alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	n-Hexane	10%	100.0	95.5	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid) , alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Acetonitrile	5%	100.0	88.9	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid) , alcohol	—	—	Classical aqueous control (in %)
Specificity - Enantioselectivity	E-value (computed as ln(1-C(1+eep))/ln(1-C(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Acetonitrile	10%	2.7	6.8	E-value	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	(R)-Ketoprofen , (S)-Ketoprofen , Ethanol	—	—	Classical aqueous control (in E-value)
Specificity - Enantioselectivity	E-value (computed as ln(1-C(1+eep))/ln(1-C(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Acetonitrile	5%	2.7	3.5	E-value	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	(R)-Ketoprofen , (S)-Ketoprofen , Ethanol	—	—	Classical aqueous control (in E-value)
Specificity - Enantioselectivity	E-value (computed as ln(1-C(1+eep))/ln(1-C(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	n-Hexane	10%	2.7	3.9	E-value	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	(R)-Ketoprofen , (S)-Ketoprofen , Ethanol	—	—	Classical aqueous control (in E-value)
Specificity - Enantioselectivity	E-value (computed as ln(1-C(1+eep))/ln(1-C(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	n-Hexane	5%	2.7	2.7	E-value	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	(R)-Ketoprofen , (S)-Ketoprofen , Ethanol	—	—	Classical aqueous control (in E-value)
Specificity - Enantioselectivity	E-value (computed as ln(1-C(1+eep))/ln(1-C(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	1-Propanol	10%	2.7	—	E-value	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	(R)-Ketoprofen , (S)-Ketoprofen , Ethanol	—	—	Classical aqueous control (in E-value)
Specificity - Enantioselectivity	E-value (computed as ln(1-C(1+eep))/ln(1-C(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	1-Propanol	5%	2.7	1.8	E-value	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	(R)-Ketoprofen , (S)-Ketoprofen , Ethanol	—	—	Classical aqueous control (in E-value)
Specificity - Enantioselectivity	E-value (computed as ln(1-C(1+eep))/ln(1-C(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	1-Butanol	10%	2.7	—	E-value	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	(R)-Ketoprofen , (S)-Ketoprofen , Ethanol	—	—	Classical aqueous control (in E-value)
Specificity - Enantioselectivity	E-value (computed as ln(1-C(1+eep))/ln(1-C(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	1-Butanol	5%	2.7	—	E-value	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	(R)-Ketoprofen , (S)-Ketoprofen , Ethanol	—	—	Classical aqueous control (in E-value)

Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Methanol	10%	100.0	91.7	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Acetonitrile	10%	100.0	69.9	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (S)-Ketoprofen ethyl ester	(S)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Acetonitrile	5%	100.0	103.2	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (S)-Ketoprofen ethyl ester	(S)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	n-Hexane	10%	100.0	116.4	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (S)-Ketoprofen ethyl ester	(S)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	n-Hexane	5%	100.0	111.9	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (S)-Ketoprofen ethyl ester	(S)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	1-Propanol	10%	100.0	0.0	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (S)-Ketoprofen ethyl ester	(S)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	1-Propanol	5%	100.0	8.5	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (S)-Ketoprofen ethyl ester	(S)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	1-Butanol	10%	100.0	0.0	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (S)-Ketoprofen ethyl ester	(S)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	1-Butanol	5%	100.0	0.0	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (S)-Ketoprofen ethyl ester	(S)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100.0	112.4	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (S)-Ketoprofen ethyl ester	(S)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	100.0	111.9	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (S)-Ketoprofen ethyl ester	(S)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Isopropanol	10%	100.0	46.6	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (S)-Ketoprofen ethyl ester	(S)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Isopropanol	5%	100.0	79.5	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (S)-Ketoprofen ethyl ester	(S)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Ethanol	10%	100.0	25.7	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (S)-Ketoprofen ethyl ester	(S)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Ethanol	5%	100.0	53.1	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (S)-Ketoprofen ethyl ester	(S)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Methanol	10%	100.0	38.5	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (S)-Ketoprofen ethyl ester	(S)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Acetonitrile	10%	100.0	29.2	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Methanol	5%	100.0	49.3	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (S)-Ketoprofen ethyl ester	(S)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Methanol	5%	100.0	97.5	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Ethanol	5%	100.0	77.1	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Ethanol	10%	100.0	40.1	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Isopropanol	5%	100.0	119.5	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Isopropanol	10%	100.0	45.5	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	100.0	132.8	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100.0	118.6	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	1-Butanol	5%	100.0	0.0	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	1-Butanol	10%	100.0	0.0	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	1-Propanol	5%	100.0	11.2	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	1-Propanol	10%	100.0	0.0	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	n-Hexane	5%	100.0	125.7	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	n-Hexane	10%	100.0	95.5	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Acetonitrile	5%	100.0	88.9	%	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM (R)-Ketoprofen ethyl ester	(R)-ketoprofen (acid), alcohol	—	—	Classical aqueous control (in %)
Specificity - Enantioselectivity	E-value (computed as ln(1-C(1+eep))/ln(1-C(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Acetonitrile	10%	2.7	6.8	E-value	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	(R)-Ketoprofen, (S)-Ketoprofen, Ethanol	—	—	Classical aqueous control (in E-value)
Specificity - Enantioselectivity	E-value (computed as ln(1-C(1+eep))/ln(1-C(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Acetonitrile	5%	2.7	3.5	E-value	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	(R)-Ketoprofen, (S)-Ketoprofen, Ethanol	—	—	Classical aqueous control (in E-value)
Specificity - Enantioselectivity	E-value (computed as ln(1-C(1+eep))/ln(1-C(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	n-Hexane	10%	2.7	3.9	E-value	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	(R)-Ketoprofen, (S)-Ketoprofen, Ethanol	—	—	Classical aqueous control (in E-value)
Specificity - Enantioselectivity	E-value (computed as ln(1-C(1+eep))/ln(1-C(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	n-Hexane	5%	2.7	2.7	E-value	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	(R)-Ketoprofen, (S)-Ketoprofen, Ethanol	—	—	Classical aqueous control (in E-value)
Specificity - Enantioselectivity	E-value (computed as ln(1-C(1+eep))/ln(1-C(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	1-Propanol	10%	2.7	—	E-value	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	(R)-Ketoprofen, (S)-Ketoprofen, Ethanol	—	—	Classical aqueous control (in E-value)
Specificity - Enantioselectivity	E-value (computed as ln(1-C(1+eep))/ln(1-C(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	1-Propanol	5%	2.7	1.8	E-value	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	(R)-Ketoprofen, (S)-Ketoprofen, Ethanol	—	—	Classical aqueous control (in E-value)
Specificity - Enantioselectivity	E-value (computed as ln(1-C(1+eep))/ln(1-C(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	1-Butanol	10%	2.7	—	E-value	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	(R)-Ketoprofen, (S)-Ketoprofen, Ethanol	—	—	Classical aqueous control (in E-value)
Specificity - Enantioselectivity	E-value (computed as ln(1-C(1+eep))/ln(1-C(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	1-Butanol	5%	2.7	—	E-value	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	(R)-Ketoprofen, (S)-Ketoprofen, Ethanol	—	—	Classical aqueous control (in E-value)
Specificity - Enantioselectivity	E-value (computed as ln(1-C(1+eep))/ln(1-C(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	2.7	2.9	E-value	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	(R)-Ketoprofen, (S)-Ketoprofen, Ethanol	—	—	Classical aqueous control (in E-value)
Specificity - Enantioselectivity	E-value (computed as ln(1-C(1+eep))/ln(1-C(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	2.7	2.5	E-value	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	(R)-Ketoprofen, (S)-Ketoprofen, Ethanol	—	—	Classical aqueous control (in E-value)
Specificity - Enantioselectivity	E-value (computed as ln(1-C(1+eep))/ln(1-C(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Isopropanol	10%	2.7	2.7	E-value	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	(R)-Ketoprofen, (S)-Ketoprofen, Ethanol	—	—	Classical aqueous control (in E-value)
Specificity - Enantioselectivity	E-value (computed as ln(1-C(1+eep))/ln(1-C(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Isopropanol	5%	2.7	1.8	E-value	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	(R)-Ketoprofen, (S)-Ketoprofen, Ethanol	—	—	Classical aqueous control (in E-value)
Specificity - Enantioselectivity	E-value (computed as ln(1-C(1+eep))/ln(1-C(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Ethanol	10%	2.7	1.6	E-value	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	(R)-Ketoprofen, (S)-Ketoprofen, Ethanol	—	—	Classical aqueous control (in E-value)
Specificity - Enantioselectivity	E-value (computed as ln(1-C(1+eep))/ln(1-C(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Ethanol	5%	2.7	1.8	E-value	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	(R)-Ketoprofen, (S)-Ketoprofen, Ethanol	—	—	Classical aqueous control (in E-value)
Specificity - Enantioselectivity	E-value (computed as ln(1-C(1+eep))/ln(1-C(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Methanol	10%	2.7	1.0	E-value	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	(R)-Ketoprofen, (S)-Ketoprofen, Ethanol	—	—	Classical aqueous control (in E-value)
Specificity - Enantioselectivity	E-value (computed as ln(1-C(1+eep))/ln(1-C(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60°C) in the presence of organic solvent	Methanol	5%	2.7	1.3	E-value	200 mM glycine-NaOH buffer, 0.1% Triton X-100	10	60°C	5 mM Ethyl 2-(3-benzoylphenyl)propanoate	(R)-Ketoprofen, (S)-Ketoprofen, Ethanol	—	—	Classical aqueous control (in E-value)

‹ Prev

1 2 3

Next ›

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Specificity — Enantioselectivity