Esterase (gene Est-gela) from Bacillus gelatini KACC 12197

Enzyme Description

Extremophile
No but "thermostable" enzyme
EC Number

Sequence

Length: 389 amino acids
MPDLLTNVAENYVNQDLFAGIEWRIDQDGKPIFQGCAGVKDIETRTFIPKNAIYRIYSMTKPIVSFLAMMLIERGVFRLSSPIQNFDPRFKSMKVIDQHAHIEPATALITIEHLLTHQAGFSYDFSLGCPISAHYRDAQLIEDGGRDLTDMMGVLAELPLVFHPGTQWKYSISTDVLAHIIECATGERVDDLLQRLIFDPLDMQDTGFSLPLDGASRLMEVYGMRSLHGLPALKPAPHVLVPADLGSSHPTDDPDFRRGGHGLYSTLDDYMAFANMLLSGQTPEGETLLSPAMLKLALAPRVYFGAGGMRINDEPFAGYSWNLLGRVMTDVGAAAYATHLGEFGWSGAAATYFWVDPTKNMTGCVMTQFLGSQHPIGSDMQAAAMSMLG
Jinyeong Kim et al. (2015) β€” Cloning and characterization of a novel thermostable esterase from Bacillus gelatini KACC 12197
Protein Expression and Purification  Β· doi:10.1016/j.pep.2015.08.009 β†—  Β· Activity - Classical Selectivity - Enantioselectivity
48 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli XL1-blue

Experimental Data (48 measurements)

48 measurements β€” page 2 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Ethanol 10% 100.0 40.1 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (R)-Ketoprofen ethyl ester (R)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Isopropanol 5% 100.0 119.5 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (R)-Ketoprofen ethyl ester (R)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Isopropanol 10% 100.0 45.5 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (R)-Ketoprofen ethyl ester (R)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5% 100.0 132.8 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (R)-Ketoprofen ethyl ester (R)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10% 100.0 118.6 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (R)-Ketoprofen ethyl ester (R)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent 1-Butanol 5% 100.0 0.0 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (R)-Ketoprofen ethyl ester (R)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent 1-Butanol 10% 100.0 0.0 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (R)-Ketoprofen ethyl ester (R)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent 1-Propanol 5% 100.0 11.2 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (R)-Ketoprofen ethyl ester (R)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent 1-Propanol 10% 100.0 0.0 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (R)-Ketoprofen ethyl ester (R)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent n-Hexane 5% 100.0 125.7 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (R)-Ketoprofen ethyl ester (R)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent n-Hexane 10% 100.0 95.5 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (R)-Ketoprofen ethyl ester (R)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Acetonitrile 5% 100.0 88.9 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (R)-Ketoprofen ethyl ester (R)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Selectivity - Enantioselectivity E-value (computed as ln(1-C*(1+eep))/ln(1-C*(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Acetonitrile 10% 2.7 6.8 E-value 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM Ethyl 2-(3-benzoylphenyl)propanoate (R)-Ketoprofen , (S)-Ketoprofen , Ethanol β€” β€” Classical aqueous control (in E-value)
Selectivity - Enantioselectivity E-value (computed as ln(1-C*(1+eep))/ln(1-C*(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Acetonitrile 5% 2.7 3.5 E-value 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM Ethyl 2-(3-benzoylphenyl)propanoate (R)-Ketoprofen , (S)-Ketoprofen , Ethanol β€” β€” Classical aqueous control (in E-value)
Selectivity - Enantioselectivity E-value (computed as ln(1-C*(1+eep))/ln(1-C*(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent n-Hexane 10% 2.7 3.9 E-value 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM Ethyl 2-(3-benzoylphenyl)propanoate (R)-Ketoprofen , (S)-Ketoprofen , Ethanol β€” β€” Classical aqueous control (in E-value)
Selectivity - Enantioselectivity E-value (computed as ln(1-C*(1+eep))/ln(1-C*(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent n-Hexane 5% 2.7 2.7 E-value 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM Ethyl 2-(3-benzoylphenyl)propanoate (R)-Ketoprofen , (S)-Ketoprofen , Ethanol β€” β€” Classical aqueous control (in E-value)
Selectivity - Enantioselectivity E-value (computed as ln(1-C*(1+eep))/ln(1-C*(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent 1-Propanol 10% 2.7 β€” E-value 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM Ethyl 2-(3-benzoylphenyl)propanoate (R)-Ketoprofen , (S)-Ketoprofen , Ethanol β€” β€” Classical aqueous control (in E-value)
Selectivity - Enantioselectivity E-value (computed as ln(1-C*(1+eep))/ln(1-C*(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent 1-Propanol 5% 2.7 1.8 E-value 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM Ethyl 2-(3-benzoylphenyl)propanoate (R)-Ketoprofen , (S)-Ketoprofen , Ethanol β€” β€” Classical aqueous control (in E-value)
Selectivity - Enantioselectivity E-value (computed as ln(1-C*(1+eep))/ln(1-C*(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent 1-Butanol 10% 2.7 β€” E-value 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM Ethyl 2-(3-benzoylphenyl)propanoate (R)-Ketoprofen , (S)-Ketoprofen , Ethanol β€” β€” Classical aqueous control (in E-value)
Selectivity - Enantioselectivity E-value (computed as ln(1-C*(1+eep))/ln(1-C*(1-eep)) with eep being S-R/S+R), determined by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent 1-Butanol 5% 2.7 β€” E-value 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM Ethyl 2-(3-benzoylphenyl)propanoate (R)-Ketoprofen , (S)-Ketoprofen , Ethanol β€” β€” Classical aqueous control (in E-value)
1 2 3

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Selectivity - Enantioselectivity

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*