Esterase (gene Est-gela) from Bacillus gelatini KACC 12197

Enzyme Description

Extremophile
No but "thermostable" enzyme
EC Number

Sequence

Length: 389 amino acids
MPDLLTNVAENYVNQDLFAGIEWRIDQDGKPIFQGCAGVKDIETRTFIPKNAIYRIYSMTKPIVSFLAMMLIERGVFRLSSPIQNFDPRFKSMKVIDQHAHIEPATALITIEHLLTHQAGFSYDFSLGCPISAHYRDAQLIEDGGRDLTDMMGVLAELPLVFHPGTQWKYSISTDVLAHIIECATGERVDDLLQRLIFDPLDMQDTGFSLPLDGASRLMEVYGMRSLHGLPALKPAPHVLVPADLGSSHPTDDPDFRRGGHGLYSTLDDYMAFANMLLSGQTPEGETLLSPAMLKLALAPRVYFGAGGMRINDEPFAGYSWNLLGRVMTDVGAAAYATHLGEFGWSGAAATYFWVDPTKNMTGCVMTQFLGSQHPIGSDMQAAAMSMLG
Jinyeong Kim et al. (2015) β€” Cloning and characterization of a novel thermostable esterase from Bacillus gelatini KACC 12197
Protein Expression and Purification  Β· doi:10.1016/j.pep.2015.08.009 β†—  Β· Activity - Classical Selectivity - Enantioselectivity
48 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli XL1-blue

Experimental Data (48 measurements)

48 measurements β€” page 1 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Methanol 10% 100.0 91.7 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (R)-Ketoprofen ethyl ester (R)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Acetonitrile 10% 100.0 69.9 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (S)-Ketoprofen ethyl ester (S)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Acetonitrile 5% 100.0 103.2 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (S)-Ketoprofen ethyl ester (S)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent n-Hexane 10% 100.0 116.4 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (S)-Ketoprofen ethyl ester (S)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent n-Hexane 5% 100.0 111.9 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (S)-Ketoprofen ethyl ester (S)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent 1-Propanol 10% 100.0 0.0 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (S)-Ketoprofen ethyl ester (S)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent 1-Propanol 5% 100.0 8.5 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (S)-Ketoprofen ethyl ester (S)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent 1-Butanol 10% 100.0 0.0 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (S)-Ketoprofen ethyl ester (S)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent 1-Butanol 5% 100.0 0.0 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (S)-Ketoprofen ethyl ester (S)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10% 100.0 112.4 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (S)-Ketoprofen ethyl ester (S)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5% 100.0 111.9 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (S)-Ketoprofen ethyl ester (S)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Isopropanol 10% 100.0 46.6 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (S)-Ketoprofen ethyl ester (S)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Isopropanol 5% 100.0 79.5 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (S)-Ketoprofen ethyl ester (S)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Ethanol 10% 100.0 25.7 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (S)-Ketoprofen ethyl ester (S)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Ethanol 5% 100.0 53.1 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (S)-Ketoprofen ethyl ester (S)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Methanol 10% 100.0 38.5 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (S)-Ketoprofen ethyl ester (S)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Acetonitrile 10% 100.0 29.2 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (R)-Ketoprofen ethyl ester (R)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Methanol 5% 100.0 49.3 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (S)-Ketoprofen ethyl ester (S)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Methanol 5% 100.0 97.5 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (R)-Ketoprofen ethyl ester (R)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC (amount of product formation after 30 minutes incubation at 60Β°C) in the presence of organic solvent Ethanol 5% 100.0 77.1 % 200 mM glycine-NaOH buffer, 0.1% Triton X-100 10 60Β°C 5 mM (R)-Ketoprofen ethyl ester (R)-ketoprofen (acid) , alcohol β€” β€” Classical aqueous control (in %)
β€Ή Prev
1 2 3

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Selectivity - Enantioselectivity

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*