Protease (gene aprBG) from Bacillus gibsonii DSM8722

Enzyme Description

Species

Bacillus gibsonii DSM8722 ↗

Extremophile

Yes "alkaliphilic" organism

EC Number

3.4.21.19 ↗

Sequence

Length: 375 amino acids

MVGLVCVTALVTVTDSASAAEEKVKYLIGFEEEAELEAFTEEIDQVGVFSVEEQSVAEDTLDIDVDIIDEYDYTDVLAVELDPEDVDALSEEAGISFIEEDIELSIQQTVPWGITRVQAPAVHNRGITGSGVRVAILDSGISAHSDLNIRGGASFVPGEPTTADLNGHGTHVAGTVAALNNSIGVIGVAPNAELYAVKVLGANGSGSVSGIAQGLEWAATNNMHIANMSLGSDFPSSTLERAVNYATSRDVLVIAATGNNGSGSVGYPARYANAMAVGATDQNNRRANFSQYGTGIDIVAPGVNVQSTYPGNRYVSMNGTSMATPHVAGAAALVKQRYPSWNATQIRNHLKNTATNLGNSSQFGSGLVNAEAATR

Aihua Deng et al. (2014) — Secretory Expression, Functional Characterization, and Molecular Genetic Analysis of Novel Halo-Solvent-Tolerant Protease from Bacillus gibsonii

Journal of Microbiology and Biotechnology · doi:10.4014/jmb.1308.08094 ↗ · Stability - Incubation

44 measurements ▼

Database ID

UniProt: S5VEF0 ↗

Sequence Annotation

Explicit - Provided GenBank Accession Number

Protein Source

Recombinant, host bacterium Bacillus subtilis WB600

Experimental Data (44 measurements)

44 measurements — page 3 of 3

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	10%	100	94	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides , Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	50%	100	98	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides , Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Formamide	10%	100	117	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides , Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Formamide	50%	100	114	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides , Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent

Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Ethyl Acetate	50%	100	111	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	n-Hexane	50%	100	98	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Xylene	10%	100	103	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Xylene	50%	100	115	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Toluene	10%	100	99	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Toluene	50%	100	93	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Benzene	10%	100	113	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Benzene	50%	100	123	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	1-Butanol	10%	100	108	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	1-Butanol	50%	100	95	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Ethyl Acetate	10%	100	130	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	n-Hexane	10%	100	92	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Isopropanol	10%	100	110	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Isopropanol	50%	100	110	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Acetone	10%	100	98	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Acetone	50%	100	115	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Ethanol	10%	100	101	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Ethanol	50%	100	95	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	10%	100	99	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	50%	100	85	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Formamide	10%	100	102	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Formamide	50%	100	87	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Ethyl Acetate	50%	100	139	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	n-Hexane	50%	100	123	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Xylene	10%	100	114	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Xylene	50%	100	125	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Toluene	10%	100	102	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Toluene	50%	100	111	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Benzene	10%	100	125	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Benzene	50%	100	136	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	1-Butanol	10%	100	112	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	1-Butanol	50%	100	104	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Ethyl Acetate	10%	100	108	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	n-Hexane	10%	100	93	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Isopropanol	10%	100	126	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Isopropanol	50%	100	141	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Acetone	10%	100	122	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Acetone	50%	100	125	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Ethanol	10%	100	112	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Ethanol	50%	100	107	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	10%	100	94	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	50%	100	98	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Formamide	10%	100	117	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase	Formamide	50%	100	114	%	Incubation: ?, Assay: 50 mM glycine-NaOH buffer	Incubation: ?, Assay: 9.5	Incubation: Room temperature, Assay: 75°C	1% Azocasein	Azo-peptides, Peptides	—	—	Water-incubated control (in %), assay in aqueous phase \| High uncertainty about whether assay in aqueous phase or in the presence of organic solvent

‹ Prev

1 2 3

Next ›

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*