Protease (gene aprBG) from Bacillus gibsonii DSM8722

Enzyme Description

Extremophile
Yes "alkaliphilic" organism
EC Number

Sequence

Length: 375 amino acids
MVGLVCVTALVTVTDSASAAEEKVKYLIGFEEEAELEAFTEEIDQVGVFSVEEQSVAEDTLDIDVDIIDEYDYTDVLAVELDPEDVDALSEEAGISFIEEDIELSIQQTVPWGITRVQAPAVHNRGITGSGVRVAILDSGISAHSDLNIRGGASFVPGEPTTADLNGHGTHVAGTVAALNNSIGVIGVAPNAELYAVKVLGANGSGSVSGIAQGLEWAATNNMHIANMSLGSDFPSSTLERAVNYATSRDVLVIAATGNNGSGSVGYPARYANAMAVGATDQNNRRANFSQYGTGIDIVAPGVNVQSTYPGNRYVSMNGTSMATPHVAGAAALVKQRYPSWNATQIRNHLKNTATNLGNSSQFGSGLVNAEAATR
Aihua Deng et al. (2014) β€” Secretory Expression, Functional Characterization, and Molecular Genetic Analysis of Novel Halo-Solvent-Tolerant Protease from Bacillus gibsonii
Journal of Microbiology and Biotechnology  Β· doi:10.4014/jmb.1308.08094 β†—  Β· Stability - Incubation
44 measurements
Database ID
UniProt: S5VEF0 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Bacillus subtilis WB600

Experimental Data (44 measurements)

44 measurements β€” page 1 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase Ethyl Acetate 50% 100 111 % Incubation: ?, Assay: 50 mM glycine-NaOH buffer Incubation: ?, Assay: 9.5 Incubation: Room temperature, Assay: 75Β°C 1% Azocasein Azo-peptides , Peptides β€” β€” Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase n-Hexane 50% 100 98 % Incubation: ?, Assay: 50 mM glycine-NaOH buffer Incubation: ?, Assay: 9.5 Incubation: Room temperature, Assay: 75Β°C 1% Azocasein Azo-peptides , Peptides β€” β€” Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase Xylene 10% 100 103 % Incubation: ?, Assay: 50 mM glycine-NaOH buffer Incubation: ?, Assay: 9.5 Incubation: Room temperature, Assay: 75Β°C 1% Azocasein Azo-peptides , Peptides β€” β€” Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase Xylene 50% 100 115 % Incubation: ?, Assay: 50 mM glycine-NaOH buffer Incubation: ?, Assay: 9.5 Incubation: Room temperature, Assay: 75Β°C 1% Azocasein Azo-peptides , Peptides β€” β€” Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase Toluene 10% 100 99 % Incubation: ?, Assay: 50 mM glycine-NaOH buffer Incubation: ?, Assay: 9.5 Incubation: Room temperature, Assay: 75Β°C 1% Azocasein Azo-peptides , Peptides β€” β€” Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase Toluene 50% 100 93 % Incubation: ?, Assay: 50 mM glycine-NaOH buffer Incubation: ?, Assay: 9.5 Incubation: Room temperature, Assay: 75Β°C 1% Azocasein Azo-peptides , Peptides β€” β€” Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase Benzene 10% 100 113 % Incubation: ?, Assay: 50 mM glycine-NaOH buffer Incubation: ?, Assay: 9.5 Incubation: Room temperature, Assay: 75Β°C 1% Azocasein Azo-peptides , Peptides β€” β€” Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase Benzene 50% 100 123 % Incubation: ?, Assay: 50 mM glycine-NaOH buffer Incubation: ?, Assay: 9.5 Incubation: Room temperature, Assay: 75Β°C 1% Azocasein Azo-peptides , Peptides β€” β€” Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase 1-Butanol 10% 100 108 % Incubation: ?, Assay: 50 mM glycine-NaOH buffer Incubation: ?, Assay: 9.5 Incubation: Room temperature, Assay: 75Β°C 1% Azocasein Azo-peptides , Peptides β€” β€” Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase 1-Butanol 50% 100 95 % Incubation: ?, Assay: 50 mM glycine-NaOH buffer Incubation: ?, Assay: 9.5 Incubation: Room temperature, Assay: 75Β°C 1% Azocasein Azo-peptides , Peptides β€” β€” Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase Ethyl Acetate 10% 100 130 % Incubation: ?, Assay: 50 mM glycine-NaOH buffer Incubation: ?, Assay: 9.5 Incubation: Room temperature, Assay: 75Β°C 1% Azocasein Azo-peptides , Peptides β€” β€” Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase n-Hexane 10% 100 92 % Incubation: ?, Assay: 50 mM glycine-NaOH buffer Incubation: ?, Assay: 9.5 Incubation: Room temperature, Assay: 75Β°C 1% Azocasein Azo-peptides , Peptides β€” β€” Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase Isopropanol 10% 100 110 % Incubation: ?, Assay: 50 mM glycine-NaOH buffer Incubation: ?, Assay: 9.5 Incubation: Room temperature, Assay: 75Β°C 1% Azocasein Azo-peptides , Peptides β€” β€” Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase Isopropanol 50% 100 110 % Incubation: ?, Assay: 50 mM glycine-NaOH buffer Incubation: ?, Assay: 9.5 Incubation: Room temperature, Assay: 75Β°C 1% Azocasein Azo-peptides , Peptides β€” β€” Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase Acetone 10% 100 98 % Incubation: ?, Assay: 50 mM glycine-NaOH buffer Incubation: ?, Assay: 9.5 Incubation: Room temperature, Assay: 75Β°C 1% Azocasein Azo-peptides , Peptides β€” β€” Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase Acetone 50% 100 115 % Incubation: ?, Assay: 50 mM glycine-NaOH buffer Incubation: ?, Assay: 9.5 Incubation: Room temperature, Assay: 75Β°C 1% Azocasein Azo-peptides , Peptides β€” β€” Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase Ethanol 10% 100 101 % Incubation: ?, Assay: 50 mM glycine-NaOH buffer Incubation: ?, Assay: 9.5 Incubation: Room temperature, Assay: 75Β°C 1% Azocasein Azo-peptides , Peptides β€” β€” Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase Ethanol 50% 100 95 % Incubation: ?, Assay: 50 mM glycine-NaOH buffer Incubation: ?, Assay: 9.5 Incubation: Room temperature, Assay: 75Β°C 1% Azocasein Azo-peptides , Peptides β€” β€” Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 10% 100 99 % Incubation: ?, Assay: 50 mM glycine-NaOH buffer Incubation: ?, Assay: 9.5 Incubation: Room temperature, Assay: 75Β°C 1% Azocasein Azo-peptides , Peptides β€” β€” Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 50% 100 85 % Incubation: ?, Assay: 50 mM glycine-NaOH buffer Incubation: ?, Assay: 9.5 Incubation: Room temperature, Assay: 75Β°C 1% Azocasein Azo-peptides , Peptides β€” β€” Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
β€Ή Prev
1 2 3

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*