NADP-dependent malic enzyme from Sulfolobus solfataricus

Enzyme Description

Species
Sulfolobus solfataricus β†—
Extremophile
Yes "extreme thermoacidophilic" organism
EC Number
1.1.1.40 β†—

Sequence

Length: 427 amino acids
MVDAVELSRKYEGKIEIYPKVPITSYNDFALIYTPGVAEVSKAIYKDPDKSFELTSRWNTIAVVTDGTRVLGLGNIGPTAAMPVMEGKSLLFKYLGGVDAIPLPINVKSADEFTNVVKALETSFGGINLEDIESPKCFYILEKLQSMLNIPVWHDDQQGTAAAILAGLINAMILTNKDPKESKVVFYGAGASNIAAARILAKYGFKYENIVMIDSKGPLYADREDVDHLMLHHKWKYELAIKTNKWEAKEIKDAFSGADAVVAASTPGPNVIKKEWISLMNKEAIVFALANPVPEIWPQDAKEAGAKIVATGRSDFPNQVNNSLIFPAIFRGVLDSRAKAITDEMTIAASEALAKYARDRGINENYIIPRMDEWEAFYEEAAAVASKAVELGLARVKKSREEFREIAKERIIRARKIMNLVISTWSP
Annamaria Guagliardi et al. (1989) β€” Stability and activity of a thermostable malic enzyme in denaturants and water-miscible organic solvents
European Journal of Biochemistry  Β· doi:10.1111/j.1432-1033.1989.tb14891.x β†—  Β· Activity - Classical Stability - Incubation
71 measurements ▼
Database ID
UniProt: A0A7S9IJ09 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Purified, archaeon Sulfolobus solfataricus

Experimental Data (71 measurements)

71 measurements β€” page 2 of 4
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 30% 100.0 136.8 % 20 mM Tris/HCl, 50 mM ammonium sulfate, 0.1 MM MnCl2 8 45 Β°C 1 mM L-Malic acid Carbon Dioxide (CO2) , Pyruvate 0.05 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 10% 100.0 118.2 % 20 mM Tris/HCl, 50 mM ammonium sulfate, 0.1 MM MnCl2 8 45 Β°C 1 mM L-Malic acid Carbon Dioxide (CO2) , Pyruvate 0.05 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Dimethylformamide (DMF) 50% 100.0 101.4 % 20 mM Tris/HCl, 50 mM ammonium sulfate, 0.1 MM MnCl2 8 25 Β°C 1 mM L-Malic acid Carbon Dioxide (CO2) , Pyruvate 0.05 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Dimethylformamide (DMF) 30% 100.0 106.8 % 20 mM Tris/HCl, 50 mM ammonium sulfate, 0.1 MM MnCl2 8 25 Β°C 1 mM L-Malic acid Carbon Dioxide (CO2) , Pyruvate 0.05 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Dimethylformamide (DMF) 10% 100.0 111.5 % 20 mM Tris/HCl, 50 mM ammonium sulfate, 0.1 MM MnCl2 8 25 Β°C 1 mM L-Malic acid Carbon Dioxide (CO2) , Pyruvate 0.05 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 50% 100.0 109.3 % 20 mM Tris/HCl, 50 mM ammonium sulfate, 0.1 MM MnCl2 8 25 Β°C 1 mM L-Malic acid Carbon Dioxide (CO2) , Pyruvate 0.05 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 30% 100.0 110.7 % 20 mM Tris/HCl, 50 mM ammonium sulfate, 0.1 MM MnCl2 8 25 Β°C 1 mM L-Malic acid Carbon Dioxide (CO2) , Pyruvate 0.05 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 20% 100.0 112.6 % 20 mM Tris/HCl, 50 mM ammonium sulfate, 0.1 MM MnCl2 8 25 Β°C 1 mM L-Malic acid Carbon Dioxide (CO2) , Pyruvate 0.05 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 10% 100.0 114.2 % 20 mM Tris/HCl, 50 mM ammonium sulfate, 0.1 MM MnCl2 8 25 Β°C 1 mM L-Malic acid Carbon Dioxide (CO2) , Pyruvate 0.05 mM NADP+ β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in the presence of organic solvent Acetone 40% 100.0 139.4 % 20 mM Tris/HCl, 50 mM ammonium sulfate, 0.1 MM MnCl2 8 25 Β°C 1 mM L-Malic acid Carbon Dioxide (CO2) , Pyruvate 0.05 mM NADP+ β€” Classical aqueous control (in %)
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase Tetrahydrofuran (THF) 50% 100.0 50.7 % Incubation: 20 mM Tris/HCl buffer, Assay: 50 mM ammonium sulfate, 0.1 MM MnCl2 Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 60Β°C 1 mM L-Malic acid Carbon Dioxide (CO2) , Pyruvate Assay: 0.05 mM NADP+ β€” Non-incubated control (in %), assay in aqueous phase | Clear about assay conditions
Stability - Incubation Activity after incubation (24 hours at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase Tetrahydrofuran (THF) 50% 100.0 0.0 % Incubation: 20 mM Tris/HCl buffer, Assay: 50 mM ammonium sulfate, 0.1 MM MnCl2 Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 60Β°C 1 mM L-Malic acid Carbon Dioxide (CO2) , Pyruvate Assay: 0.05 mM NADP+ β€” Non-incubated control (in %), assay in aqueous phase | Clear about assay conditions
Stability - Incubation Activity after incubation (20 hours at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase Tetrahydrofuran (THF) 50% 100.0 0.0 % Incubation: 20 mM Tris/HCl buffer, Assay: 50 mM ammonium sulfate, 0.1 MM MnCl2 Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 60Β°C 1 mM L-Malic acid Carbon Dioxide (CO2) , Pyruvate Assay: 0.05 mM NADP+ β€” Non-incubated control (in %), assay in aqueous phase | Clear about assay conditions
Stability - Incubation Activity after incubation (8 hours at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase Tetrahydrofuran (THF) 50% 100.0 16.4 % Incubation: 20 mM Tris/HCl buffer, Assay: 50 mM ammonium sulfate, 0.1 MM MnCl2 Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 60Β°C 1 mM L-Malic acid Carbon Dioxide (CO2) , Pyruvate Assay: 0.05 mM NADP+ β€” Non-incubated control (in %), assay in aqueous phase | Clear about assay conditions
Stability - Incubation Activity after incubation (4 hours at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase Tetrahydrofuran (THF) 50% 100.0 26.8 % Incubation: 20 mM Tris/HCl buffer, Assay: 50 mM ammonium sulfate, 0.1 MM MnCl2 Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 60Β°C 1 mM L-Malic acid Carbon Dioxide (CO2) , Pyruvate Assay: 0.05 mM NADP+ β€” Non-incubated control (in %), assay in aqueous phase | Clear about assay conditions
Stability - Incubation Activity after incubation (2 hours at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase Tetrahydrofuran (THF) 50% 100.0 33.9 % Incubation: 20 mM Tris/HCl buffer, Assay: 50 mM ammonium sulfate, 0.1 MM MnCl2 Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 60Β°C 1 mM L-Malic acid Carbon Dioxide (CO2) , Pyruvate Assay: 0.05 mM NADP+ β€” Non-incubated control (in %), assay in aqueous phase | Clear about assay conditions
Stability - Incubation Activity after incubation (20 hours at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase Dimethylformamide (DMF) 50% 100.0 98.2 % Incubation: 20 mM Tris/HCl buffer, Assay: 50 mM ammonium sulfate, 0.1 MM MnCl2 Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 60Β°C 1 mM L-Malic acid Carbon Dioxide (CO2) , Pyruvate Assay: 0.05 mM NADP+ β€” Non-incubated control (in %), assay in aqueous phase | Clear about assay conditions
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase Ethanol 15% 100.0 95.0 % Incubation: 20 mM Tris/HCl buffer, Assay: 50 mM ammonium sulfate, 0.1 MM MnCl2 Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 60Β°C 1 mM L-Malic acid Carbon Dioxide (CO2) , Pyruvate Assay: 0.05 mM NADP+ β€” Non-incubated control (in %), assay in aqueous phase | Clear about assay conditions
Stability - Incubation Activity after incubation (24 hours at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase Methanol 50% 100.0 84.3 % Incubation: 20 mM Tris/HCl buffer, Assay: 50 mM ammonium sulfate, 0.1 MM MnCl2 Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 60Β°C 1 mM L-Malic acid Carbon Dioxide (CO2) , Pyruvate Assay: 0.05 mM NADP+ β€” Non-incubated control (in %), assay in aqueous phase | Clear about assay conditions
Stability - Incubation Activity after incubation (20 hours at 25Β°C), measured by absorbance spectrophotometry (NADPH absorbance measurement, 340 nm) in aqueous phase Methanol 50% 100.0 85.7 % Incubation: 20 mM Tris/HCl buffer, Assay: 50 mM ammonium sulfate, 0.1 MM MnCl2 Incubation: 8, Assay: 8 Incubation: 25Β°C, Assay: 60Β°C 1 mM L-Malic acid Carbon Dioxide (CO2) , Pyruvate Assay: 0.05 mM NADP+ β€” Non-incubated control (in %), assay in aqueous phase | Clear about assay conditions
β€Ή Prev
1 2 3 4
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*