6-oxo camphor hydrolase (gene camK) from Rhodococcus sp.

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 257 amino acids
MKQLATPFQEYSQKYENIRLERDGGVLLVTVHTEGKSLVWTSTAHDELAYCFHDIACDRENKVVILTGTGPSFCNEIDFTSFNLGTPHDWDEIIFEGQRLLNNLLSIEVPVIAAVNGPVTNHPEIPVMSDIVLAAESATFQDGPHFPSGIVPGDGAHVVWPHVLGSNRGRYFLLTGQELDARTALDYGAVNEVLSEQELLPRAWELARGIAEKPLLARRYARKVLTRQLRRVMEADLSLGLAHEALAAIDLGMESEQ
Elina Siirola et al. (2011) β€” Tolerance of Ξ²-diketone hydrolases as representatives of the crotonase superfamily towards organic solvents
Biotechnology and Bioengineering  Β· doi:10.1002/bit.23275 β†—  Β· Activity - Classical Stability - Incubation Selectivity - Enantioselectivity
28 measurements
Database ID
UniProt: Q93TU6 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (28 measurements)

28 measurements β€” page 1 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by HPLC in the presence of organic solvent Petroleum Ether 80% 100 49 % 50 mM phosphate buffer 7.5 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” 120 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent Diisopropyl Ether 80% 100 51 % 50 mM phosphate buffer 7.5 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” 120 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent tert-Butyl Methyl Ether (MTBE) 80% 100 5 % 50 mM phosphate buffer 7.5 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” 120 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent n-Hexane 80% 100 51 % 50 mM phosphate buffer 7.5 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” 120 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent Diethyl Ether 80% 100 32 % 50 mM phosphate buffer 7.5 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” 120 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent Toluene 80% 100 29 % 50 mM phosphate buffer 7.5 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” 120 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent Ethyl Acetate 80% 100 12 % 50 mM phosphate buffer 7.5 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” 120 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent Tetrahydrofuran (THF) 80% 100 0 % 50 mM phosphate buffer 7.5 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” 120 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent Glycerol 80% 100 5 % 50 mM phosphate buffer 7.5 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” 120 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent Ethylene Glycol 80% 100 5 % 50 mM phosphate buffer 7.5 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” 120 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent Acetonitrile 80% 100 5 % 50 mM phosphate buffer 7.5 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” 120 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent 1,4-Dioxane 80% 100 0 % 50 mM phosphate buffer 7.5 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” 120 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent Acetone 80% 100 5 % 50 mM phosphate buffer 7.5 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” 120 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward the S form) after 40 minutes of incubation in the presence of organic solvent, measured by HPLC Petroleum Ether 80% 98 >99 % 50 mM phosphate buffer 7.5 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” 120 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward the S form) after 40 minutes of incubation in the presence of organic solvent, measured by HPLC Diisopropyl Ether 80% 98 99 % 50 mM phosphate buffer 7.5 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” 120 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward the S form) after 40 minutes of incubation in the presence of organic solvent, measured by HPLC tert-Butyl Methyl Ether (MTBE) 80% 98 93 % 50 mM phosphate buffer 7.5 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” 120 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward the S form) after 40 minutes of incubation in the presence of organic solvent, measured by HPLC n-Hexane 80% 98 >99 % 50 mM phosphate buffer 7.5 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” 120 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward the S form) after 40 minutes of incubation in the presence of organic solvent, measured by HPLC Diethyl Ether 80% 98 99 % 50 mM phosphate buffer 7.5 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” 120 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward the S form) after 40 minutes of incubation in the presence of organic solvent, measured by HPLC Toluene 80% 98 >99 % 50 mM phosphate buffer 7.5 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” 120 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward the S form) after 40 minutes of incubation in the presence of organic solvent, measured by HPLC Ethyl Acetate 80% 98 >99 % 50 mM phosphate buffer 7.5 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” 120 rpm Classical aqueous control (in %)
β€Ή Prev
1 2

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Selectivity - Enantioselectivity

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*