6-oxo camphor hydrolase (gene camK) from Rhodococcus sp.

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 257 amino acids
MKQLATPFQEYSQKYENIRLERDGGVLLVTVHTEGKSLVWTSTAHDELAYCFHDIACDRENKVVILTGTGPSFCNEIDFTSFNLGTPHDWDEIIFEGQRLLNNLLSIEVPVIAAVNGPVTNHPEIPVMSDIVLAAESATFQDGPHFPSGIVPGDGAHVVWPHVLGSNRGRYFLLTGQELDARTALDYGAVNEVLSEQELLPRAWELARGIAEKPLLARRYARKVLTRQLRRVMEADLSLGLAHEALAAIDLGMESEQ
Elina Siirola et al. (2011) β€” Tolerance of Ξ²-diketone hydrolases as representatives of the crotonase superfamily towards organic solvents
Biotechnology and Bioengineering  Β· doi:10.1002/bit.23275 β†—  Β· Activity - Classical Stability - Incubation Selectivity - Enantioselectivity
28 measurements
Database ID
UniProt: Q93TU6 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (28 measurements)

28 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Selectivity - Enantioselectivity Enantiomeric excess (toward the S form) after 40 minutes of incubation in the presence of organic solvent, measured by HPLC Glycerol 80% 98 98 % 50 mM phosphate buffer 7.5 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” 120 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward the S form) after 40 minutes of incubation in the presence of organic solvent, measured by HPLC Ethylene Glycol 80% 98 82 % 50 mM phosphate buffer 7.5 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” 120 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward the S form) after 40 minutes of incubation in the presence of organic solvent, measured by HPLC Acetonitrile 80% 98 96 % 50 mM phosphate buffer 7.5 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” 120 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward the S form) after 40 minutes of incubation in the presence of organic solvent, measured by HPLC Acetone 80% 98 89 % 50 mM phosphate buffer 7.5 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” 120 rpm Classical aqueous control (in %)
Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by HPLC in aqueous phase Toluene 65 ppm water 100 96 % Incubation: /, Assay: 50 mM phosphate buffer Incubation: ?, Assay: 7.5 Incubation: 30Β°C, Assay: 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” Incubation: 120 rpm Non-incubated control (in %), activity measured in aqueous phase | Clear about assay in aqueuos phase
Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by HPLC in aqueous phase Methanol 26 ppm water 100 4 % Incubation: /, Assay: 50 mM phosphate buffer Incubation: ?, Assay: 7.5 Incubation: 30Β°C, Assay: 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” Incubation: 120 rpm Non-incubated control (in %), activity measured in aqueous phase | Clear about assay in aqueuos phase
Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by HPLC in aqueous phase Ethanol 14 ppm water 100 58 % Incubation: /, Assay: 50 mM phosphate buffer Incubation: ?, Assay: 7.5 Incubation: 30Β°C, Assay: 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” Incubation: 120 rpm Non-incubated control (in %), activity measured in aqueous phase | Clear about assay in aqueuos phase
Stability - Incubation Activity after incubation (24 hours at 30Β°C), measured by HPLC in aqueous phase Diisopropyl Ether 10 ppm water 100 99 % Incubation: /, Assay: 50 mM phosphate buffer Incubation: ?, Assay: 7.5 Incubation: 30Β°C, Assay: 30Β°C 50 mM Bicyclo(2.2.2)octane-2,6-dione (S)-2-(3-ketocyclohexyl)acetic acid β€” Incubation: 120 rpm Non-incubated control (in %), activity measured in aqueous phase | Clear about assay in aqueuos phase
1 2
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Selectivity - Enantioselectivity

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*