Haloalkane dehalogenase DbjA from Bradyrhizobium japonicum

Enzyme Description

Species

Extremophile

EC Number

3.8.1.5 ↗

Sequence

Length: 310 amino acids

MSKPIEIEIRRAPVLGSSMAYRETGAQDAPVVLFLHGNPTSSHIWRNILPLVSPVAHCIAPDLIGFGQSGKPDIAYRFFDHVRYLDAFIEQRGVTSAYLVAQDWGTALAFHLAARRPDFVRGLAFMEFIRPMPTWQDFHHTEVAEEQDHAEAARAVFRKFRTPGEGEAMILEANAFVERVLPGGIVRKLGDEEMAPYRTPFPTPESRRPVLAFPRELPIAGEPADVYEALQSAHAALAASSYPKLLFTGEPGALVSPEFAERFAASLTRCALIRLGAGLHYLQEDHADAIGRSVAGWIAGIEAVRPQLAA

Veronika Stepankova et al. (2013) — Organic co-solvents affect activity, stability and enantioselectivity of haloalkane dehalogenases

Biotechnology Journal · doi:10.1002/biot.201200378 ↗ · Activity - Classical Stability - C50 Stability - Tm Specificity - Enantioselectivity

152 measurements ▼

Database ID

UniProt: P59337 ↗

Sequence Annotation

Inferred - from protein name

Protein Source

Recombinant, host bacterium Escherichia coli BL21

Experimental Data (152 measurements)

152 measurements — page 8 of 8

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Ethylene Glycol	20%	52.5	51.0	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), averaged between circular dichroism and DSC measurements
Stability - Tm	Tm measured by DSC in the presence of organic solvent	Dimethylformamide (DMF)	20%	52.5	36.0	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), averaged between circular dichroism and DSC measurements
Stability - Tm	Tm measured by DSC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	52.5	48.0	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), averaged between circular dichroism and DSC measurements
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Methanol	20%	52.5	46.0	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), averaged between circular dichroism and DSC measurements
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	1,4-Dioxane	20%	52.5	35.0	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), averaged between circular dichroism and DSC measurements
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Acetonitrile	10%	52.5	41.0	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), averaged between circular dichroism and DSC measurements
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Acetonitrile	20%	52.5	0.0	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), averaged between circular dichroism and DSC measurements
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Ethanol	20%	52.5	40.0	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), averaged between circular dichroism and DSC measurements
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Acetone	20%	52.5	34.0	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), averaged between circular dichroism and DSC measurements
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Isopropanol	20%	52.5	36.0	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), averaged between circular dichroism and DSC measurements
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Tetrahydrofuran (THF)	10%	52.5	34.0	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), averaged between circular dichroism and DSC measurements
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Tetrahydrofuran (THF)	20%	52.5	<10.0	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), averaged between circular dichroism and DSC measurements

Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Glycerol	5%	100.0	109.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Formamide	5%	100.0	73.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethylene Glycol	5%	100.0	95.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-1000	5%	100.0	136.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-10000	5%	100.0	102.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethylformamide (DMF)	5%	100.0	121.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	100.0	101.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Methanol	5%	100.0	93.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	1,4-Dioxane	5%	100.0	121.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetonitrile	5%	100.0	117.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethanol	5%	100.0	106.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetone	5%	100.0	113.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Isopropanol	5%	100.0	147.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	5%	100.0	141.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Glycerol	10%	100.0	102.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Formamide	10%	100.0	76.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethylene Glycol	10%	100.0	131.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-1000	10%	100.0	136.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-10000	10%	100.0	98.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethylformamide (DMF)	10%	100.0	131.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100.0	107.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Methanol	10%	100.0	128.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	1,4-Dioxane	10%	100.0	139.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetonitrile	10%	100.0	124.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethanol	10%	100.0	91.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetone	10%	100.0	145.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Isopropanol	10%	100.0	150.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	10%	100.0	78.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Glycerol	20%	100.0	139.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Formamide	20%	100.0	16.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethylene Glycol	20%	100.0	152.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-1000	20%	100.0	139.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-10000	20%	100.0	53.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethylformamide (DMF)	20%	100.0	105.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100.0	109.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Methanol	20%	100.0	146.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	1,4-Dioxane	20%	100.0	35.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetonitrile	20%	100.0	10.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethanol	20%	100.0	102.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetone	20%	100.0	105.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Isopropanol	20%	100.0	101.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	20%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Glycerol	30%	100.0	145.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Formamide	30%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethylene Glycol	30%	100.0	184.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-1000	30%	100.0	142.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-10000	30%	100.0	57.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethylformamide (DMF)	30%	100.0	8.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	30%	100.0	101.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Methanol	30%	100.0	143.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	1,4-Dioxane	30%	100.0	12.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetonitrile	30%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethanol	30%	100.0	19.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetone	30%	100.0	14.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Isopropanol	30%	100.0	8.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	30%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Glycerol	40%	100.0	145.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Formamide	40%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethylene Glycol	40%	100.0	182.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-1000	40%	100.0	139.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-10000	40%	100.0	46.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethylformamide (DMF)	40%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	40%	100.0	72.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Methanol	40%	100.0	12.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	1,4-Dioxane	40%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetonitrile	40%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethanol	40%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetone	40%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Isopropanol	40%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	40%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Glycerol	50%	100.0	136.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Formamide	50%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethylene Glycol	50%	100.0	169.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-1000	50%	100.0	137.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-10000	50%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethylformamide (DMF)	50%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	50%	100.0	25.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Methanol	50%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	1,4-Dioxane	50%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetonitrile	50%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethanol	50%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetone	50%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Isopropanol	50%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	50%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Glycerol	60%	100.0	114.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Formamide	60%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethylene Glycol	60%	100.0	167.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-1000	60%	100.0	116.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-10000	60%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethylformamide (DMF)	60%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	60%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Methanol	60%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	1,4-Dioxane	60%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetonitrile	60%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethanol	60%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetone	60%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Isopropanol	60%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	60%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Glycerol	75%	100.0	108.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Formamide	75%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethylene Glycol	75%	100.0	43.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-1000	75%	100.0	111.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	PEG-10000	75%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethylformamide (DMF)	75%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	75%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Methanol	75%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	1,4-Dioxane	75%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetonitrile	75%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethanol	75%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetone	75%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Isopropanol	75%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	75%	100.0	0.0	%	glycine 100 mM	8.6	37	? mM 1-Iodohexane	1-Hexanol, Iodide ion	—	—	Classical aqueous control (in %)
Specificity - Enantioselectivity	E-value (positivie values for the R form) measured gas chromatography in the presence of organic solvent in the presence of organic solvent	Ethylene Glycol	50%	1.0	3.0	relative units, (kcat/Km)R/(kcat/Km	Tris-sulfate 50 mM	8.2	20	0.5 mM 2-Bromobutane	2-Butanol, Bromide ion	—	—	Classical aqueous control (in relative units, (kcat/Km)R/(kcat/Km)S)
Specificity - Enantioselectivity	E-value (positivie values for the R form) measured gas chromatography in the presence of organic solvent in the presence of organic solvent	1,4-Dioxane	20%	1.0	1.0	relative units, (kcat/Km)R/(kcat/Km	Tris-sulfate 50 mM	8.2	20	0.5 mM 2-Bromobutane	2-Butanol, Bromide ion	—	—	Classical aqueous control (in relative units, (kcat/Km)R/(kcat/Km)S)
Specificity - Enantioselectivity	E-value (positivie values for the R form) measured gas chromatography in the presence of organic solvent in the presence of organic solvent	Ethylene Glycol	50%	132.0	>200.0	relative units, (kcat/Km)R/(kcat/Km	Tris-sulfate 50 mM	8.2	20	0.5 mM 2-Bromopentane	2-Pentanol, Bromide ion	—	—	Classical aqueous control (in relative units, (kcat/Km)R/(kcat/Km)S)
Specificity - Enantioselectivity	E-value (positivie values for the R form) measured gas chromatography in the presence of organic solvent in the presence of organic solvent	Formamide	5%	132.0	93.0	relative units, (kcat/Km)R/(kcat/Km	Tris-sulfate 50 mM	8.2	20	0.5 mM 2-Bromopentane	2-Pentanol, Bromide ion	—	—	Classical aqueous control (in relative units, (kcat/Km)R/(kcat/Km)S)
Specificity - Enantioselectivity	E-value (positivie values for the R form) measured gas chromatography in the presence of organic solvent in the presence of organic solvent	Dimethylformamide (DMF)	10%	132.0	133.0	relative units, (kcat/Km)R/(kcat/Km	Tris-sulfate 50 mM	8.2	20	0.5 mM 2-Bromopentane	2-Pentanol, Bromide ion	—	—	Classical aqueous control (in relative units, (kcat/Km)R/(kcat/Km)S)
Specificity - Enantioselectivity	E-value (positivie values for the R form) measured gas chromatography in the presence of organic solvent in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	132.0	143.0	relative units, (kcat/Km)R/(kcat/Km	Tris-sulfate 50 mM	8.2	20	0.5 mM 2-Bromopentane	2-Pentanol, Bromide ion	—	—	Classical aqueous control (in relative units, (kcat/Km)R/(kcat/Km)S)
Specificity - Enantioselectivity	E-value (positivie values for the R form) measured gas chromatography in the presence of organic solvent in the presence of organic solvent	Methanol	20%	132.0	124.0	relative units, (kcat/Km)R/(kcat/Km	Tris-sulfate 50 mM	8.2	20	0.5 mM 2-Bromopentane	2-Pentanol, Bromide ion	—	—	Classical aqueous control (in relative units, (kcat/Km)R/(kcat/Km)S)
Specificity - Enantioselectivity	E-value (positivie values for the R form) measured gas chromatography in the presence of organic solvent in the presence of organic solvent	1,4-Dioxane	10%	132.0	194.0	relative units, (kcat/Km)R/(kcat/Km	Tris-sulfate 50 mM	8.2	20	0.5 mM 2-Bromopentane	2-Pentanol, Bromide ion	—	—	Classical aqueous control (in relative units, (kcat/Km)R/(kcat/Km)S)
Specificity - Enantioselectivity	E-value (positivie values for the R form) measured gas chromatography in the presence of organic solvent in the presence of organic solvent	1,4-Dioxane	20%	132.0	>200.0	relative units, (kcat/Km)R/(kcat/Km	Tris-sulfate 50 mM	8.2	20	0.5 mM 2-Bromopentane	2-Pentanol, Bromide ion	—	—	Classical aqueous control (in relative units, (kcat/Km)R/(kcat/Km)S)
Specificity - Enantioselectivity	E-value (positivie values for the R form) measured gas chromatography in the presence of organic solvent in the presence of organic solvent	Acetonitrile	10%	132.0	134.0	relative units, (kcat/Km)R/(kcat/Km	Tris-sulfate 50 mM	8.2	20	0.5 mM 2-Bromopentane	2-Pentanol, Bromide ion	—	—	Classical aqueous control (in relative units, (kcat/Km)R/(kcat/Km)S)
Specificity - Enantioselectivity	E-value (positivie values for the R form) measured gas chromatography in the presence of organic solvent in the presence of organic solvent	Ethanol	20%	132.0	29.0	relative units, (kcat/Km)R/(kcat/Km	Tris-sulfate 50 mM	8.2	20	0.5 mM 2-Bromopentane	2-Pentanol, Bromide ion	—	—	Classical aqueous control (in relative units, (kcat/Km)R/(kcat/Km)S)
Specificity - Enantioselectivity	E-value (positivie values for the R form) measured gas chromatography in the presence of organic solvent in the presence of organic solvent	Acetone	10%	132.0	107.0	relative units, (kcat/Km)R/(kcat/Km	Tris-sulfate 50 mM	8.2	20	0.5 mM 2-Bromopentane	2-Pentanol, Bromide ion	—	—	Classical aqueous control (in relative units, (kcat/Km)R/(kcat/Km)S)
Specificity - Enantioselectivity	E-value (positivie values for the R form) measured gas chromatography in the presence of organic solvent in the presence of organic solvent	Isopropanol	10%	132.0	27.0	relative units, (kcat/Km)R/(kcat/Km	Tris-sulfate 50 mM	8.2	20	0.5 mM 2-Bromopentane	2-Pentanol, Bromide ion	—	—	Classical aqueous control (in relative units, (kcat/Km)R/(kcat/Km)S)
Specificity - Enantioselectivity	E-value (positivie values for the R form) measured gas chromatography in the presence of organic solvent in the presence of organic solvent	Tetrahydrofuran (THF)	5%	132.0	29.0	relative units, (kcat/Km)R/(kcat/Km	Tris-sulfate 50 mM	8.2	20	0.5 mM 2-Bromopentane	2-Pentanol, Bromide ion	—	—	Classical aqueous control (in relative units, (kcat/Km)R/(kcat/Km)S)
Specificity - Enantioselectivity	E-value (positivie values for the R form) measured gas chromatography in the presence of organic solvent in the presence of organic solvent	Ethylene Glycol	50%	8.0	30.0	relative units, (kcat/Km)R/(kcat/Km	Tris-sulfate 50 mM	8.2	20	0.5 mM 2-Bromohexane	2-Hexanol, Bromide ion	—	—	Classical aqueous control (in relative units, (kcat/Km)R/(kcat/Km)S)
Specificity - Enantioselectivity	E-value (positivie values for the R form) measured gas chromatography in the presence of organic solvent in the presence of organic solvent	1,4-Dioxane	20%	8.0	48.0	relative units, (kcat/Km)R/(kcat/Km	Tris-sulfate 50 mM	8.2	20	0.5 mM 2-Bromohexane	2-Hexanol, Bromide ion	—	—	Classical aqueous control (in relative units, (kcat/Km)R/(kcat/Km)S)
Stability - C50	Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Glycerol	—	—	75.0	% (v/v)	glycine 100 mM	8.6	37	1-Iodohexane	1-Hexanol, Iodide ion	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Formamide	—	—	14.0	% (v/v)	glycine 100 mM	8.6	37	1-Iodohexane	1-Hexanol, Iodide ion	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethylene Glycol	—	—	74.0	% (v/v)	glycine 100 mM	8.6	37	1-Iodohexane	1-Hexanol, Iodide ion	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	—	—	44.0	% (v/v)	glycine 100 mM	8.6	37	1-Iodohexane	1-Hexanol, Iodide ion	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Dimethylformamide (DMF)	—	—	26.0	% (v/v)	glycine 100 mM	8.6	37	1-Iodohexane	1-Hexanol, Iodide ion	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Methanol	—	—	37.0	% (v/v)	glycine 100 mM	8.6	37	1-Iodohexane	1-Hexanol, Iodide ion	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetonitrile	—	—	15.0	% (v/v)	glycine 100 mM	8.6	37	1-Iodohexane	1-Hexanol, Iodide ion	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Ethanol	—	—	21.0	% (v/v)	glycine 100 mM	8.6	37	1-Iodohexane	1-Hexanol, Iodide ion	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	1,4-Dioxane	—	—	20.0	% (v/v)	glycine 100 mM	8.6	37	1-Iodohexane	1-Hexanol, Iodide ion	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Acetone	—	—	26.0	% (v/v)	glycine 100 mM	8.6	37	1-Iodohexane	1-Hexanol, Iodide ion	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Isopropanol	—	—	25.0	% (v/v)	glycine 100 mM	8.6	37	1-Iodohexane	1-Hexanol, Iodide ion	—	—	Not applicable control (in % (v/v))
Stability - C50	Volume fraction of organic solvent at which 50% of enzyme activity is lost, measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent	Tetrahydrofuran (THF)	—	—	12.0	% (v/v)	glycine 100 mM	8.6	37	1-Iodohexane	1-Hexanol, Iodide ion	—	—	Not applicable control (in % (v/v))
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Ethylene Glycol	20%	52.5	51.0	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), averaged between circular dichroism and DSC measurements
Stability - Tm	Tm measured by DSC in the presence of organic solvent	Dimethylformamide (DMF)	20%	52.5	36.0	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), averaged between circular dichroism and DSC measurements
Stability - Tm	Tm measured by DSC in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	52.5	48.0	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), averaged between circular dichroism and DSC measurements
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Methanol	20%	52.5	46.0	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), averaged between circular dichroism and DSC measurements
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	1,4-Dioxane	20%	52.5	35.0	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), averaged between circular dichroism and DSC measurements
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Acetonitrile	10%	52.5	41.0	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), averaged between circular dichroism and DSC measurements
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Acetonitrile	20%	52.5	0.0	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), averaged between circular dichroism and DSC measurements
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Ethanol	20%	52.5	40.0	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), averaged between circular dichroism and DSC measurements
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Acetone	20%	52.5	34.0	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), averaged between circular dichroism and DSC measurements
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Isopropanol	20%	52.5	36.0	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), averaged between circular dichroism and DSC measurements
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Tetrahydrofuran (THF)	10%	52.5	34.0	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), averaged between circular dichroism and DSC measurements
Stability - Tm	Tm measured by circular dichroism in the presence of organic solvent	Tetrahydrofuran (THF)	20%	52.5	<10.0	°C	50 mM phosphate buffer	7.5	—	—	—	—	—	Classical aqueous control (in °C), averaged between circular dichroism and DSC measurements

‹ Prev

1 … 5 6 7 8

Next ›

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability — T_m

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability — C₅₀

One bar per measurement. Colour = solvent, shade = temperature. Hover for details.

Visualization : Specificity — Enantioselectivity

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*

Haloalkane dehalogenase DbjA from Bradyrhizobium japonicum

Enzyme Description

Sequence

Experimental Data (152 measurements)

Visualization : Activity — Classical

Visualization : Stability — Tm

Visualization : Stability — C50

Visualization : Specificity — Enantioselectivity

Structure

Loading…

Visualization : Stability — T_m

Visualization : Stability — C₅₀