Haloalkane dehalogenase DbjA from Bradyrhizobium japonicum

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 310 amino acids
MSKPIEIEIRRAPVLGSSMAYRETGAQDAPVVLFLHGNPTSSHIWRNILPLVSPVAHCIAPDLIGFGQSGKPDIAYRFFDHVRYLDAFIEQRGVTSAYLVAQDWGTALAFHLAARRPDFVRGLAFMEFIRPMPTWQDFHHTEVAEEQDHAEAARAVFRKFRTPGEGEAMILEANAFVERVLPGGIVRKLGDEEMAPYRTPFPTPESRRPVLAFPRELPIAGEPADVYEALQSAHAALAASSYPKLLFTGEPGALVSPEFAERFAASLTRCALIRLGAGLHYLQEDHADAIGRSVAGWIAGIEAVRPQLAA
Veronika Stepankova et al. (2013) β€” Organic co-solvents affect activity, stability and enantioselectivity of haloalkane dehalogenases
Biotechnology Journal  Β· doi:10.1002/biot.201200378 β†—  Β· Activity - Classical Stability - C50 Stability - Tm Specificity - Enantioselectivity
152 measurements
Database ID
UniProt: P59337 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Escherichia coli BL21

Experimental Data (152 measurements)

152 measurements β€” page 2 of 8
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10% 100.0 107.0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Methanol 10% 100.0 128.0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent 1,4-Dioxane 10% 100.0 139.0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Acetonitrile 10% 100.0 124.0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Ethanol 10% 100.0 91.0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Acetone 10% 100.0 145.0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Isopropanol 10% 100.0 150.0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Tetrahydrofuran (THF) 10% 100.0 78.0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Glycerol 20% 100.0 139.0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Formamide 20% 100.0 16.0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Ethylene Glycol 20% 100.0 152.0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent PEG-1000 20% 100.0 139.0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent PEG-10000 20% 100.0 53.0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Dimethylformamide (DMF) 20% 100.0 105.0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20% 100.0 109.0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Methanol 20% 100.0 146.0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent 1,4-Dioxane 20% 100.0 35.0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Acetonitrile 20% 100.0 10.0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Ethanol 20% 100.0 102.0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Acetone 20% 100.0 105.0 % glycine 100 mM 8.6 37 ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
1 2 3 4 … 8

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Tm

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” C50

One bar per measurement. Colour = solvent, shade = temperature. Hover for details.

Visualization : Specificity β€” Enantioselectivity

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*