Ene-reductase from Thermoanaerobacter pseudethanolicus E39
Enzyme Description
Extremophile
Yes
"thermophilic" organism
EC Number
Sequence
MSILHMPLKIKDITIKNRIMMSPMCMYSASTDGMPNDWHIVHYATRAIGGVGLIMQEATAVESRGRITDHDLGIWNDEQVKELKKIVDICKANGAVMGIQLAHAGRKCNISYEDVVGPSPIKAGDRYKLPRELSVEEIKSIVKAFGEAAKRANLAGYDVVEIHAAHGYLIHEFLSPLSNKRKDEYGNSIENRARFLIEVIDEVRKNWPENKPIFVRVSADDYMEGGINIDMMVEYINMIKDKVDLIDVSSGGLLNVDINLYPGYQVKYAETIKKRCNIKTSAVGLITTQELAEEILSNERADLVALGRELLRNPYWVLHTYTSKEDWPKQYERAFKK
BjΓΆrn V. AdalbjΓΆrnsson et al. (2010)
β Biocatalysis with Thermostable Enzymes: Structure and Properties of a Thermophilic 'ene '-Reductase related to Old Yellow Enzyme
ChemBioChem
Β· doi:10.1002/cbic.200900570 β
Β· Activity + Stability - Product Formation Selectivity - Enantioselectivity
▼
Database ID
UniProt: B0KAH1 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli
Experimental Data (24 measurements)
24 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity + Stability - Product Formation | Yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, determined by gas chromatography | Dimethylformamide (DMF) | 10% | 74 | 42 | % | 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) | 7 | 30Β°C | 5 mM Ketoisophorone | Levodione | 6 mM NADH | 130 rpm | Classical aqueous control (in %) |
| Activity + Stability - Product Formation | Yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, determined by gas chromatography | Dimethylformamide (DMF) | 5% | 74 | 64 | % | 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) | 7 | 30Β°C | 5 mM Ketoisophorone | Levodione | 6 mM NADH | 130 rpm | Classical aqueous control (in %) |
| Activity + Stability - Product Formation | Yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, determined by gas chromatography | Acetonitrile | 10% | 74 | 66 | % | 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) | 7 | 30Β°C | 5 mM Ketoisophorone | Levodione | 6 mM NADH | 130 rpm | Classical aqueous control (in %) |
| Activity + Stability - Product Formation | Yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, determined by gas chromatography | Acetone | 10% | 74 | 36 | % | 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) | 7 | 30Β°C | 5 mM Ketoisophorone | Levodione | 6 mM NADH | 130 rpm | Classical aqueous control (in %) |
| Activity + Stability - Product Formation | Yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, determined by gas chromatography | 1-Propanol | 10% | 74 | 54 | % | 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) | 7 | 30Β°C | 5 mM Ketoisophorone | Levodione | 6 mM NADH | 130 rpm | Classical aqueous control (in %) |
| Activity + Stability - Product Formation | Yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, determined by gas chromatography | Ethanol | 10% | 74 | 65 | % | 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) | 7 | 30Β°C | 5 mM Ketoisophorone | Levodione | 6 mM NADH | 130 rpm | Classical aqueous control (in %) |
| Activity + Stability - Product Formation | Yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, determined by gas chromatography | Methanol | 10% | 74 | 66 | % | 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) | 7 | 30Β°C | 5 mM Ketoisophorone | Levodione | 6 mM NADH | 130 rpm | Classical aqueous control (in %) |
| Activity + Stability - Product Formation | Yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, determined by gas chromatography | Tetrahydrofuran (THF) | 10% | 74 | 69 | % | 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) | 7 | 30Β°C | 5 mM Ketoisophorone | Levodione | 6 mM NADH | 130 rpm | Classical aqueous control (in %) |
| Activity + Stability - Product Formation | Yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, determined by gas chromatography | Dimethylformamide (DMF) | 10% | 74 | 37 | % | 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) | 7 | 30Β°C | 5 mM Ketoisophorone | Levodione | 6 mM NADH | 130 rpm | Classical aqueous control (in %) |
| Activity + Stability - Product Formation | Yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, determined by gas chromatography | Dimethylformamide (DMF) | 30% | 74 | 12 | % | 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) | 7 | 30Β°C | 5 mM Ketoisophorone | Levodione | 6 mM NADH | 130 rpm | Classical aqueous control (in %) |
| Activity + Stability - Product Formation | Yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, determined by gas chromatography | Dimethylformamide (DMF) | 20% | 74 | 23 | % | 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) | 7 | 30Β°C | 5 mM Ketoisophorone | Levodione | 6 mM NADH | 130 rpm | Classical aqueous control (in %) |
| Activity + Stability - Product Formation | Yield after incubation (2 hours at 30Β°C) in the presence of organic solvent, determined by gas chromatography | Dimethylformamide (DMF) | 15% | 74 | 32 | % | 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) | 7 | 30Β°C | 5 mM Ketoisophorone | Levodione | 6 mM NADH | 130 rpm | Classical aqueous control (in %) |
| Selectivity - Enantioselectivity | Enantiomeric excess (toward R form) after incubation (2 hours at 30Β°C in the presence of organic solvent, measured by gas chromatography | Acetonitrile | 10% | 26 | 93 | % | 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) | 7 | 30Β°C | 5 mM Ketoisophorone | Levodione | 6 mM NADH | 130 rpm | Classical aqueous control (in %) |
| Selectivity - Enantioselectivity | Enantiomeric excess (toward R form) after incubation (2 hours at 30Β°C in the presence of organic solvent, measured by gas chromatography | Acetone | 10% | 26 | 93 | % | 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) | 7 | 30Β°C | 5 mM Ketoisophorone | Levodione | 6 mM NADH | 130 rpm | Classical aqueous control (in %) |
| Selectivity - Enantioselectivity | Enantiomeric excess (toward R form) after incubation (2 hours at 30Β°C in the presence of organic solvent, measured by gas chromatography | 1-Propanol | 10% | 26 | 90 | % | 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) | 7 | 30Β°C | 5 mM Ketoisophorone | Levodione | 6 mM NADH | 130 rpm | Classical aqueous control (in %) |
| Selectivity - Enantioselectivity | Enantiomeric excess (toward R form) after incubation (2 hours at 30Β°C in the presence of organic solvent, measured by gas chromatography | Ethanol | 10% | 26 | 95 | % | 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) | 7 | 30Β°C | 5 mM Ketoisophorone | Levodione | 6 mM NADH | 130 rpm | Classical aqueous control (in %) |
| Selectivity - Enantioselectivity | Enantiomeric excess (toward R form) after incubation (2 hours at 30Β°C in the presence of organic solvent, measured by gas chromatography | Methanol | 10% | 26 | 92 | % | 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) | 7 | 30Β°C | 5 mM Ketoisophorone | Levodione | 6 mM NADH | 130 rpm | Classical aqueous control (in %) |
| Selectivity - Enantioselectivity | Enantiomeric excess (toward R form) after incubation (2 hours at 30Β°C in the presence of organic solvent, measured by gas chromatography | Tetrahydrofuran (THF) | 10% | 26 | 93 | % | 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) | 7 | 30Β°C | 5 mM Ketoisophorone | Levodione | 6 mM NADH | 130 rpm | Classical aqueous control (in %) |
| Selectivity - Enantioselectivity | Enantiomeric excess (toward R form) after incubation (2 hours at 30Β°C in the presence of organic solvent, measured by gas chromatography | Dimethylformamide (DMF) | 10% | 26 | 93 | % | 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) | 7 | 30Β°C | 5 mM Ketoisophorone | Levodione | 6 mM NADH | 130 rpm | Classical aqueous control (in %) |
| Selectivity - Enantioselectivity | Enantiomeric excess (toward R form) after incubation (2 hours at 30Β°C in the presence of organic solvent, measured by gas chromatography | Dimethylformamide (DMF) | 30% | 26 | 92 | % | 50 mM potassium phosphate buffer, 2% DMF (Dimethylformamide) | 7 | 30Β°C | 5 mM Ketoisophorone | Levodione | 6 mM NADH | 130 rpm | Classical aqueous control (in %) |
Visualization : Activity + Stability β Product Formation
One bar per measurement. Colour = solvent, shade = solvent volume.
Visualization : Selectivity - Enantioselectivity
One bar per measurement. Colour = solvent, shade = solvent volume.