Ene-reductase XenA from Pseudomonas putida

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 363 amino acids
MSALFEPYTLKDVTLRNRIAIPPMCQYMAEDGLINDWHQVHYASMARGGAGLLVVEATAVAPEGRITPGCAGIWSDAHAQAFVPVVQAIKAAGSVPGIQIAHAGRKASANRPWEGDDHIGADDARGWETIAPSAIAFGAHLPNVPRAMTLDDIARVKQDFVDAARRARDAGFEWIELHFAHGYLGQSFFSEHSNKRTDAYGGSFDNRSRFLLETLAAVREVWPENLPLTARFGVLEYDGRDEQTLEESIELARRFKAGGLDLLSVSVGFTIPETNIPWGPAFMGPIAERVRREAKLPVTSAWGFGTPQLAEAALQANQLDLVSVGRAHLADPHWAYFAAKELGVEKASWTLPAPYAHWLERYR
Frieda A. Sorgenfrei et al. (2024) β€” Solvent concentration at 50% protein unfolding may reform enzyme stability ranking and process window identification
Nature Communications  Β· doi:10.1038/s41467-024-49774-0 β†—  Β· Activity - Classical Stability - Tm
60 measurements
Database ID
UniProt: Q9R9V9 β†—
Sequence Annotation
Explicit - Provided UniProt Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (60 measurements)

60 measurements β€” page 2 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 15% 100.0 68.4 % 50 mM sodium phosphate 7.4 Room temperature 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 20% 100.0 10.5 % 50 mM sodium phosphate 7.4 Room temperature 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 25% 100.0 0.0 % 50 mM sodium phosphate 7.4 Room temperature 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 30% 100.0 0.0 % 50 mM sodium phosphate 7.4 Room temperature 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent 1-Propanol 5% 100.0 57.9 % 50 mM sodium phosphate 7.4 Room temperature 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent 1-Propanol 10% 100.0 31.6 % 50 mM sodium phosphate 7.4 Room temperature 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent 1-Propanol 15% 100.0 10.5 % 50 mM sodium phosphate 7.4 Room temperature 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent 1-Propanol 20% 100.0 0.0 % 50 mM sodium phosphate 7.4 Room temperature 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent 1-Propanol 25% 100.0 0.0 % 50 mM sodium phosphate 7.4 Room temperature 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent 1-Propanol 30% 100.0 0.0 % 50 mM sodium phosphate 7.4 Room temperature 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Methanol 20% 49.0 38.67 Β°C 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10% 49.0 47.0 Β°C 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 15% 49.0 47.0 Β°C 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20% 49.0 46.33 Β°C 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 25% 49.0 46.0 Β°C 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30% 49.0 46.0 Β°C 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Ethanol 5% 49.0 45.67 Β°C 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Ethanol 10% 49.0 41.0 Β°C 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Ethanol 15% 49.0 38.33 Β°C 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Ethanol 20% 49.0 34.67 Β°C 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
1 2 3

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Tm

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*