Carboxylesterase from Sulfolobus solfataricus P1

Enzyme Description

Species

Sulfolobus solfataricus P1 ↗

Extremophile

Yes "thermoacidophilic" organism

EC Number

3.1.1.1 ↗

Sequence

Length: 305 amino acids

MPLDPTIKRLLESGFVIPIGKVPVDEVRKVFRQISSAAPKMDVGNIEDIKIPGTETMIPARVYYPKTKGPYGILVYLHGGGFVIGDIESYDPVCRAITNACNCVVASIDYRLAPENKFPSAVVDSVDATKWIYENAESLEGKQGVAVGGDSAGGNLSAVVSILTKGKINLKHQVLIYPATGADYTSRSMVEYYDGYFLTREQIEWFGSQYLRSYMDLLDIKFSPILIQDLSGLPPALIITAEYDPLRDQGEAYANKLLMAGIPVTSVRFNNVIHGFVSFFPLIPQGMDAIGLIGSTLTVAFYNSF

Y PARK et al. (2006) — A carboxylesterase from the thermoacidophilic archaeon Sulfolobus solfataricus P1; purification, characterization, and expression

Biochimica et Biophysica Acta (BBA) - General Subjects · doi:10.1016/j.bbagen.2006.01.009 ↗ · Stability - Incubation

24 measurements ▼

Database ID

—

Sequence Annotation

Explicit - Provided

Protein Source

Purified, archaeon Sulfolobus solfataricus P1

Experimental Data (24 measurements)

24 measurements — page 2 of 2

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Incubation	Activity after incubation (0 hour at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	90%	100	78	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 30°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (0 hour at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	40%	100	96	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 30°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (0 hour at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetone	40%	100	76	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 30°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (0 hour at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Ethanol	40%	100	95	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 30°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol , Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase

Stability - Incubation	Activity after incubation (1 hour at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	90%	100	27	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 30°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	90%	100	34	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetone	90%	100	20	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Ethanol	90%	100	9	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	90%	100	3	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	40%	100	87	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetone	40%	100	58	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Ethanol	40%	100	83	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	40%	100	77	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	90%	100	45	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 30°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetone	90%	100	43	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 30°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Ethanol	90%	100	32	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 30°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (0 hour at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	40%	100	88	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 30°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	40%	100	91	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 30°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetone	40%	100	61	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 30°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Ethanol	40%	100	90	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 30°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	40%	100	86	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 30°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (0 hour at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	90%	100	93	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 30°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (0 hour at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetone	90%	100	76	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 30°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (0 hour at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Ethanol	90%	100	82	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 30°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (0 hour at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	90%	100	78	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 30°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (0 hour at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	40%	100	96	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 30°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (0 hour at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetone	40%	100	76	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 30°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase
Stability - Incubation	Activity after incubation (0 hour at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Ethanol	40%	100	95	%	Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers	Incubation: 7, Assay: 8	Incubation: 30°C, Assay: 50°C	0.5 mM p-Nitrophenyl palmitate	p-Nitrophenol, Palmitic Acid	—	—	Non-incubated control (in %), assay in aqueous phase \| Clear about assay in aqueous phase

‹ Prev

1 2

Next ›

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*