Carboxylesterase from Sulfolobus solfataricus P1
Enzyme Description
Species
Extremophile
Yes
"thermoacidophilic" organism
EC Number
Sequence
MPLDPTIKRLLESGFVIPIGKVPVDEVRKVFRQISSAAPKMDVGNIEDIKIPGTETMIPARVYYPKTKGPYGILVYLHGGGFVIGDIESYDPVCRAITNACNCVVASIDYRLAPENKFPSAVVDSVDATKWIYENAESLEGKQGVAVGGDSAGGNLSAVVSILTKGKINLKHQVLIYPATGADYTSRSMVEYYDGYFLTREQIEWFGSQYLRSYMDLLDIKFSPILIQDLSGLPPALIITAEYDPLRDQGEAYANKLLMAGIPVTSVRFNNVIHGFVSFFPLIPQGMDAIGLIGSTLTVAFYNSF
Y PARK et al. (2006)
β A carboxylesterase from the thermoacidophilic archaeon Sulfolobus solfataricus P1; purification, characterization, and expression
Biochimica et Biophysica Acta (BBA) - General Subjects
Β· doi:10.1016/j.bbagen.2006.01.009 β
Β· Stability - Incubation
▼
Database ID
β
Sequence Annotation
Explicit - Provided
Protein Source
Purified, archaeon Sulfolobus solfataricus P1
Experimental Data (24 measurements)
24 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 90% | 100 | 27 | % | Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers | Incubation: 7, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 0.5 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 90% | 100 | 34 | % | Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 50Β°C | 0.5 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetone | 90% | 100 | 20 | % | Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 50Β°C | 0.5 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 90% | 100 | 9 | % | Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 50Β°C | 0.5 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 90% | 100 | 3 | % | Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 50Β°C | 0.5 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 40% | 100 | 87 | % | Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 50Β°C | 0.5 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetone | 40% | 100 | 58 | % | Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 50Β°C | 0.5 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 40% | 100 | 83 | % | Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 50Β°C | 0.5 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 40% | 100 | 77 | % | Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 50Β°C | 0.5 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 90% | 100 | 45 | % | Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers | Incubation: 7, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 0.5 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetone | 90% | 100 | 43 | % | Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers | Incubation: 7, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 0.5 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 90% | 100 | 32 | % | Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers | Incubation: 7, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 0.5 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (0 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 40% | 100 | 88 | % | Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers | Incubation: 7, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 0.5 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 40% | 100 | 91 | % | Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers | Incubation: 7, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 0.5 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetone | 40% | 100 | 61 | % | Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers | Incubation: 7, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 0.5 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 40% | 100 | 90 | % | Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers | Incubation: 7, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 0.5 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 40% | 100 | 86 | % | Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers | Incubation: 7, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 0.5 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (0 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 90% | 100 | 93 | % | Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers | Incubation: 7, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 0.5 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (0 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetone | 90% | 100 | 76 | % | Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers | Incubation: 7, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 0.5 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (0 hour at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 90% | 100 | 82 | % | Incubation: 100 mM sodium phosphate, Assay: 100 mM sodium phosphate buffer with sodium taurocholate (2 mg/ml) and gum arabic (1 mg/ml) as emulsifiers | Incubation: 7, Assay: 8 | Incubation: 30Β°C, Assay: 50Β°C | 0.5 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.