Fructose bisphosphate aldolase from Escherichia coli

Enzyme Description

Species
Escherichia coli β†—
Extremophile
No
EC Number
4.1.2.13 β†—

Sequence

Length: 358 amino acids
SKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTGGEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPTILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL
J. Hao et al. (2004) β€” A thermostable variant of fructose bisphosphate aldolase constructed by directed evolution also shows increased stability in organic solvents
Protein Engineering Design and Selection  Β· doi:10.1093/protein/gzh081 β†—  Β· Stability - Incubation Activity + Stability - Incubation
12 measurements ▼
Database ID
UniProt: P0AB71 β†—
Sequence Annotation
Explicit - Provided (first residue from UniProt sequence absent from the mature protein)
Protein Source
Recombinant, host bacterium Escherichia coli KM3

Experimental Data (12 measurements)

12 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + Stability - Incubation Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in the presence of organic solvent Toluene 20% 68 60 % Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 4 mM Fructose 1,6-biphosphate Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent
Activity + Stability - Incubation Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in the presence of organic solvent n-Hexane 20% 68 69 % Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 4 mM Fructose 1,6-biphosphate Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent
Activity + Stability - Incubation Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in the presence of organic solvent Dimethylformamide (DMF) 20% 68 4 % Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 4 mM Fructose 1,6-biphosphate Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent
Activity + Stability - Incubation Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in the presence of organic solvent Acetonitrile 20% 68 10 % Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 4 mM Fructose 1,6-biphosphate Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent
Activity + Stability - Incubation Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in the presence of organic solvent Chloroform 20% 68 29 % Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 4 mM Fructose 1,6-biphosphate Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent
Activity + Stability - Incubation Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in the presence of organic solvent Methanol 20% 68 66 % Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 4 mM Fructose 1,6-biphosphate Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate β€” β€” Water-incubated control (in %), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase Toluene 20% 73 41 % Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 4 mM Fructose 1,6-biphosphate Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate β€” β€” Water-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase n-Hexane 20% 73 55 % Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 4 mM Fructose 1,6-biphosphate Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate β€” β€” Water-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase Dimethylformamide (DMF) 20% 73 26 % Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 4 mM Fructose 1,6-biphosphate Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate β€” β€” Water-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase Acetonitrile 20% 73 16 % Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 4 mM Fructose 1,6-biphosphate Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate β€” β€” Water-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase Chloroform 20% 73 54 % Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 4 mM Fructose 1,6-biphosphate Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate β€” β€” Water-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase Methanol 20% 73 64 % Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 4 mM Fructose 1,6-biphosphate Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate β€” β€” Water-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume. β€” β€” β€” Reference value. Hover for details.

Visualization : Activity + Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume. β€” β€” β€” Reference value. Hover for details.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*