UDP-glucuronosyltransferase 2B15 from Homo sapiens
Enzyme Description
Sequence
MSLKWTSVFLLIQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVTVLTSSASTLVNASKSSAIKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYYDYSNKLCKDAVLNKKLMMKLQESKFDVILADALNPCGELLAELFNIPFLYSLRFSVGYTFEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIHMLYFDFWFQIYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDLLNALKSVINDPVYKENVMKLSRIHHDQPMKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHSLDVIAFLLACVATVIFIITKFCLFCFRKLAKKGKKKKRD
Verawan Uchaipichat et al. (2004)
β Human udp-glucuronosyltransferases: isoform selectivity and kinetics of 4-methylumbelliferone and 1-naphthol glucuronidation, effects of organic solvents, and inhibition by diclofenac and probenecid
Drug Metabolism and Disposition
Β· doi:10.1124/dmd.32.4.413 β
Β· Activity - Classical
▼
Database ID
UniProt: P54855 β
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host human HEK293 cells
Experimental Data (12 measurements)
12 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by fluorescence spectrophotometry (4-methylumbelliferone glucuronide fluorescence measurement, excitation at 315 nm, absorbance measurement at 365 nm) in the presence of organic solvent | Methanol | 0.5% | 100 | 98 | % | 0.1 M phosphate buffer, 5 mM MgClβ | 7.4 | 37Β°C | 300 Β΅M 4-Methylumbelliferyl Ξ²-D-glucuronide, 5 mM Uridine 5'-diphosphoglucuronic acid trisodium salt | 4-methylumbelliferone glucuronide , UDP | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by fluorescence spectrophotometry (4-methylumbelliferone glucuronide fluorescence measurement, excitation at 315 nm, absorbance measurement at 365 nm) in the presence of organic solvent | Methanol | 1% | 100 | 89 | % | 0.1 M phosphate buffer, 5 mM MgClβ | 7.4 | 37Β°C | 300 Β΅M 4-Methylumbelliferyl Ξ²-D-glucuronide, 5 mM Uridine 5'-diphosphoglucuronic acid trisodium salt | 4-methylumbelliferone glucuronide , UDP | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by fluorescence spectrophotometry (4-methylumbelliferone glucuronide fluorescence measurement, excitation at 315 nm, absorbance measurement at 365 nm) in the presence of organic solvent | Methanol | 2% | 100 | 64 | % | 0.1 M phosphate buffer, 5 mM MgClβ | 7.4 | 37Β°C | 300 Β΅M 4-Methylumbelliferyl Ξ²-D-glucuronide, 5 mM Uridine 5'-diphosphoglucuronic acid trisodium salt | 4-methylumbelliferone glucuronide , UDP | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by fluorescence spectrophotometry (4-methylumbelliferone glucuronide fluorescence measurement, excitation at 315 nm, absorbance measurement at 365 nm) in the presence of organic solvent | Methanol | 4% | 100 | 34 | % | 0.1 M phosphate buffer, 5 mM MgClβ | 7.4 | 37Β°C | 300 Β΅M 4-Methylumbelliferyl Ξ²-D-glucuronide, 5 mM Uridine 5'-diphosphoglucuronic acid trisodium salt | 4-methylumbelliferone glucuronide , UDP | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by fluorescence spectrophotometry (4-methylumbelliferone glucuronide fluorescence measurement, excitation at 315 nm, absorbance measurement at 365 nm) in the presence of organic solvent | Acetone | 0.5% | 100 | 84 | % | 0.1 M phosphate buffer, 5 mM MgClβ | 7.4 | 37Β°C | 300 Β΅M 4-Methylumbelliferyl Ξ²-D-glucuronide, 5 mM Uridine 5'-diphosphoglucuronic acid trisodium salt | 4-methylumbelliferone glucuronide , UDP | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by fluorescence spectrophotometry (4-methylumbelliferone glucuronide fluorescence measurement, excitation at 315 nm, absorbance measurement at 365 nm) in the presence of organic solvent | Acetone | 1% | 100 | 67 | % | 0.1 M phosphate buffer, 5 mM MgClβ | 7.4 | 37Β°C | 300 Β΅M 4-Methylumbelliferyl Ξ²-D-glucuronide, 5 mM Uridine 5'-diphosphoglucuronic acid trisodium salt | 4-methylumbelliferone glucuronide , UDP | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by fluorescence spectrophotometry (4-methylumbelliferone glucuronide fluorescence measurement, excitation at 315 nm, absorbance measurement at 365 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 0.5% | 100 | 95 | % | 0.1 M phosphate buffer, 5 mM MgClβ | 7.4 | 37Β°C | 300 Β΅M 4-Methylumbelliferyl Ξ²-D-glucuronide, 5 mM Uridine 5'-diphosphoglucuronic acid trisodium salt | 4-methylumbelliferone glucuronide , UDP | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by fluorescence spectrophotometry (4-methylumbelliferone glucuronide fluorescence measurement, excitation at 315 nm, absorbance measurement at 365 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 1% | 100 | 90 | % | 0.1 M phosphate buffer, 5 mM MgClβ | 7.4 | 37Β°C | 300 Β΅M 4-Methylumbelliferyl Ξ²-D-glucuronide, 5 mM Uridine 5'-diphosphoglucuronic acid trisodium salt | 4-methylumbelliferone glucuronide , UDP | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by fluorescence spectrophotometry (4-methylumbelliferone glucuronide fluorescence measurement, excitation at 315 nm, absorbance measurement at 365 nm) in the presence of organic solvent | Acetonitrile | 0.5% | 100 | 73 | % | 0.1 M phosphate buffer, 5 mM MgClβ | 7.4 | 37Β°C | 300 Β΅M 4-Methylumbelliferyl Ξ²-D-glucuronide, 5 mM Uridine 5'-diphosphoglucuronic acid trisodium salt | 4-methylumbelliferone glucuronide , UDP | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by fluorescence spectrophotometry (4-methylumbelliferone glucuronide fluorescence measurement, excitation at 315 nm, absorbance measurement at 365 nm) in the presence of organic solvent | Acetonitrile | 1% | 100 | 49 | % | 0.1 M phosphate buffer, 5 mM MgClβ | 7.4 | 37Β°C | 300 Β΅M 4-Methylumbelliferyl Ξ²-D-glucuronide, 5 mM Uridine 5'-diphosphoglucuronic acid trisodium salt | 4-methylumbelliferone glucuronide , UDP | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by fluorescence spectrophotometry (4-methylumbelliferone glucuronide fluorescence measurement, excitation at 315 nm, absorbance measurement at 365 nm) in the presence of organic solvent | Ethanol | 0.5% | 100 | 109 | % | 0.1 M phosphate buffer, 5 mM MgClβ | 7.4 | 37Β°C | 300 Β΅M 4-Methylumbelliferyl Ξ²-D-glucuronide, 5 mM Uridine 5'-diphosphoglucuronic acid trisodium salt | 4-methylumbelliferone glucuronide , UDP | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by fluorescence spectrophotometry (4-methylumbelliferone glucuronide fluorescence measurement, excitation at 315 nm, absorbance measurement at 365 nm) in the presence of organic solvent | Ethanol | 1% | 100 | 88 | % | 0.1 M phosphate buffer, 5 mM MgClβ | 7.4 | 37Β°C | 300 Β΅M 4-Methylumbelliferyl Ξ²-D-glucuronide, 5 mM Uridine 5'-diphosphoglucuronic acid trisodium salt | 4-methylumbelliferone glucuronide , UDP | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.