Alcohol dehydrogenase from Thermoanaerobacter brockii

Enzyme Description

Species
Thermoanaerobacter brockii β†—
Extremophile
Yes thermophilic organism
EC Number
1.1.1.1 β†—

Sequence

Length: 352 amino acids
MKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDRVVVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHGAELADIELGATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKDGPIESQIMNLTEGKGVDAAIIAGGNADIMATAVKIVKPGGTIANVNYFGEGEVLPVPRLEWGCGMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDPSKLVTHVFRGFDNIEKAFMLMKDKPKDLIKPVVILA
Murillo Villela Filho et al. (2003) β€” Is log P a Convenient Criterion to Guide the Choice of Solvents for Biphasic Enzymatic Reactions?
Angewandte Chemie International Edition  Β· doi:10.1002/anie.200351089 β†—  Β· Stability - Half-life
10 measurements ▼
Database ID
UniProt: P14941 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Commercially purchased

Experimental Data (10 measurements)

10 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Half-life Half-life (in hours) in organic solvent, likely measured by absorbance spectrophotometry (NADH absorbance measurement) in aqueous phase tert-Butanol 50% 480 376 hours Incubation: Phosphate buffer, Assay: Phosphate buffer Incubation: 7, Assay: 7 Incubation: 4Β°C, Assay: 30Β°C 10 mM Acetophenone 1-Phenylethanol Assay: 0.2 mM NADPH Yes, incubation "stirred continuously" Classical aqueous control (in hours) | Deducted assay method
Stability - Half-life Half-life (in hours) in organic solvent, likely measured by absorbance spectrophotometry (NADH absorbance measurement) in aqueous phase Ethyl Acetate 50% 480 24 hours Incubation: Phosphate buffer, Assay: Phosphate buffer Incubation: 7, Assay: 7 Incubation: 4Β°C, Assay: 30Β°C 10 mM Acetophenone 1-Phenylethanol Assay: 0.2 mM NADPH Yes, incubation "stirred continuously" Classical aqueous control (in hours) | Deducted assay method
Stability - Half-life Half-life (in hours) in organic solvent, likely measured by absorbance spectrophotometry (NADH absorbance measurement) in aqueous phase Diethyl Ether 50% 480 562 hours Incubation: Phosphate buffer, Assay: Phosphate buffer Incubation: 7, Assay: 7 Incubation: 4Β°C, Assay: 30Β°C 10 mM Acetophenone 1-Phenylethanol Assay: 0.2 mM NADPH Yes, incubation "stirred continuously" Classical aqueous control (in hours) | Deducted assay method
Stability - Half-life Half-life (in hours) in organic solvent, likely measured by absorbance spectrophotometry (NADH absorbance measurement) in aqueous phase tert-Butyl Methyl Ether (MTBE) 50% 480 1884 hours Incubation: Phosphate buffer, Assay: Phosphate buffer Incubation: 7, Assay: 7 Incubation: 4Β°C, Assay: 30Β°C 10 mM Acetophenone 1-Phenylethanol Assay: 0.2 mM NADPH Yes, incubation "stirred continuously" Classical aqueous control (in hours) | Deducted assay method
Stability - Half-life Half-life (in hours) in organic solvent, likely measured by absorbance spectrophotometry (NADH absorbance measurement) in aqueous phase Dichloromethane 50% 480 1 hours Incubation: Phosphate buffer, Assay: Phosphate buffer Incubation: 7, Assay: 7 Incubation: 4Β°C, Assay: 30Β°C 10 mM Acetophenone 1-Phenylethanol Assay: 0.2 mM NADPH Yes, incubation "stirred continuously" Classical aqueous control (in hours) | Deducted assay method
Stability - Half-life Half-life (in hours) in organic solvent, likely measured by absorbance spectrophotometry (NADH absorbance measurement) in aqueous phase Diisopropyl Ether 50% 480 668 hours Incubation: Phosphate buffer, Assay: Phosphate buffer Incubation: 7, Assay: 7 Incubation: 4Β°C, Assay: 30Β°C 10 mM Acetophenone 1-Phenylethanol Assay: 0.2 mM NADPH Yes, incubation "stirred continuously" Classical aqueous control (in hours) | Deducted assay method
Stability - Half-life Half-life (in hours) in organic solvent, likely measured by absorbance spectrophotometry (NADH absorbance measurement) in aqueous phase Toluene 50% 480 7 hours Incubation: Phosphate buffer, Assay: Phosphate buffer Incubation: 7, Assay: 7 Incubation: 4Β°C, Assay: 30Β°C 10 mM Acetophenone 1-Phenylethanol Assay: 0.2 mM NADPH Yes, incubation "stirred continuously" Classical aqueous control (in hours) | Deducted assay method
Stability - Half-life Half-life (in hours) in organic solvent, likely measured by absorbance spectrophotometry (NADH absorbance measurement) in aqueous phase Butyl Ether 50% 480 5 hours Incubation: Phosphate buffer, Assay: Phosphate buffer Incubation: 7, Assay: 7 Incubation: 4Β°C, Assay: 30Β°C 10 mM Acetophenone 1-Phenylethanol Assay: 0.2 mM NADPH Yes, incubation "stirred continuously" Classical aqueous control (in hours) | Deducted assay method
Stability - Half-life Half-life (in hours) in organic solvent, likely measured by absorbance spectrophotometry (NADH absorbance measurement) in aqueous phase Cyclohexane 50% 480 8 hours Incubation: Phosphate buffer, Assay: Phosphate buffer Incubation: 7, Assay: 7 Incubation: 4Β°C, Assay: 30Β°C 10 mM Acetophenone 1-Phenylethanol Assay: 0.2 mM NADPH Yes, incubation "stirred continuously" Classical aqueous control (in hours) | Deducted assay method
Stability - Half-life Half-life (in hours) in organic solvent, likely measured by absorbance spectrophotometry (NADH absorbance measurement) in aqueous phase n-Nonane 50% 480 1 hours Incubation: Phosphate buffer, Assay: Phosphate buffer Incubation: 7, Assay: 7 Incubation: 4Β°C, Assay: 30Β°C 10 mM Acetophenone 1-Phenylethanol Assay: 0.2 mM NADPH Yes, incubation "stirred continuously" Classical aqueous control (in hours) | Deducted assay method

Visualization : Stability β€” Half-life

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*