Superoxide dismutase from Cohnella sp. A01
Enzyme Description
Sequence
MAHVLPPLPYAKDALEPYIDATTMEIHHDRHHNTYVTNLNKALESAPELANKSVEELISDLNAVPESIRTAVRNNGGGHANHSLFWETIGPNGGGAPTGALAAAIDSELGGFEKFKETFSNAAATRFGSGWAWLALGKDGKLKVYSLPNQDSPLMEGDTPLLGLDVWEHAYYLKYQNKRPDYIAAFWNVVNWEKVGALYDAAKK
Zahra Karimi Mazraeh Shahi et al. (2021)
β Thermophilic iron containing type superoxide dismutase from Cohnella sp. A01
International Journal of Biological Macromolecules
Β· doi:10.1016/j.ijbiomac.2021.07.150 β
Β· Activity - Classical
▼
Database ID
NCBI: KX857493.1 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (15 measurements)
15 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (measurement of NBT-formazan absorbance decline due to superoxide radicals production, 560 nm) in the presence of organic solvent | Methanol | 5% | 100.0 | 91.9 | % | 100 mM potassium phosphate buffer, 0.5 MM EDTA, 7 Β΅M riboflavin, 25 mM methionine, 90 Β΅M NBT | 8.2 | 45Β°C | ? mM H+, ? mM Oββ» | HβOβ (Hydrogen Peroxide) , Oβ | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (measurement of NBT-formazan absorbance decline due to superoxide radicals production, 560 nm) in the presence of organic solvent | Methanol | 10% | 100.0 | 106.7 | % | 100 mM potassium phosphate buffer, 0.5 MM EDTA, 7 Β΅M riboflavin, 25 mM methionine, 90 Β΅M NBT | 8.2 | 45Β°C | ? mM H+, ? mM Oββ» | HβOβ (Hydrogen Peroxide) , Oβ | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (measurement of NBT-formazan absorbance decline due to superoxide radicals production, 560 nm) in the presence of organic solvent | Ethanol | 5% | 100.0 | 107.4 | % | 100 mM potassium phosphate buffer, 0.5 MM EDTA, 7 Β΅M riboflavin, 25 mM methionine, 90 Β΅M NBT | 8.2 | 45Β°C | ? mM H+, ? mM Oββ» | HβOβ (Hydrogen Peroxide) , Oβ | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (measurement of NBT-formazan absorbance decline due to superoxide radicals production, 560 nm) in the presence of organic solvent | Ethanol | 10% | 100.0 | 108.0 | % | 100 mM potassium phosphate buffer, 0.5 MM EDTA, 7 Β΅M riboflavin, 25 mM methionine, 90 Β΅M NBT | 8.2 | 45Β°C | ? mM H+, ? mM Oββ» | HβOβ (Hydrogen Peroxide) , Oβ | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (measurement of NBT-formazan absorbance decline due to superoxide radicals production, 560 nm) in the presence of organic solvent | Isopropanol | 5% | 100.0 | 106.0 | % | 100 mM potassium phosphate buffer, 0.5 MM EDTA, 7 Β΅M riboflavin, 25 mM methionine, 90 Β΅M NBT | 8.2 | 45Β°C | ? mM H+, ? mM Oββ» | HβOβ (Hydrogen Peroxide) , Oβ | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (measurement of NBT-formazan absorbance decline due to superoxide radicals production, 560 nm) in the presence of organic solvent | Isopropanol | 10% | 100.0 | 104.7 | % | 100 mM potassium phosphate buffer, 0.5 MM EDTA, 7 Β΅M riboflavin, 25 mM methionine, 90 Β΅M NBT | 8.2 | 45Β°C | ? mM H+, ? mM Oββ» | HβOβ (Hydrogen Peroxide) , Oβ | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (measurement of NBT-formazan absorbance decline due to superoxide radicals production, 560 nm) in the presence of organic solvent | Isobutanol | 5% | 100.0 | 118.1 | % | 100 mM potassium phosphate buffer, 0.5 MM EDTA, 7 Β΅M riboflavin, 25 mM methionine, 90 Β΅M NBT | 8.2 | 45Β°C | ? mM H+, ? mM Oββ» | HβOβ (Hydrogen Peroxide) , Oβ | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (measurement of NBT-formazan absorbance decline due to superoxide radicals production, 560 nm) in the presence of organic solvent | Glycerol | 5% | 100.0 | 110.1 | % | 100 mM potassium phosphate buffer, 0.5 MM EDTA, 7 Β΅M riboflavin, 25 mM methionine, 90 Β΅M NBT | 8.2 | 45Β°C | ? mM H+, ? mM Oββ» | HβOβ (Hydrogen Peroxide) , Oβ | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (measurement of NBT-formazan absorbance decline due to superoxide radicals production, 560 nm) in the presence of organic solvent | Glycerol | 10% | 100.0 | 130.2 | % | 100 mM potassium phosphate buffer, 0.5 MM EDTA, 7 Β΅M riboflavin, 25 mM methionine, 90 Β΅M NBT | 8.2 | 45Β°C | ? mM H+, ? mM Oββ» | HβOβ (Hydrogen Peroxide) , Oβ | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (measurement of NBT-formazan absorbance decline due to superoxide radicals production, 560 nm) in the presence of organic solvent | Acetone | 5% | 100.0 | 94.0 | % | 100 mM potassium phosphate buffer, 0.5 MM EDTA, 7 Β΅M riboflavin, 25 mM methionine, 90 Β΅M NBT | 8.2 | 45Β°C | ? mM H+, ? mM Oββ» | HβOβ (Hydrogen Peroxide) , Oβ | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (measurement of NBT-formazan absorbance decline due to superoxide radicals production, 560 nm) in the presence of organic solvent | Acetone | 10% | 100.0 | 108.7 | % | 100 mM potassium phosphate buffer, 0.5 MM EDTA, 7 Β΅M riboflavin, 25 mM methionine, 90 Β΅M NBT | 8.2 | 45Β°C | ? mM H+, ? mM Oββ» | HβOβ (Hydrogen Peroxide) , Oβ | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (measurement of NBT-formazan absorbance decline due to superoxide radicals production, 560 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 5% | 100.0 | 112.7 | % | 100 mM potassium phosphate buffer, 0.5 MM EDTA, 7 Β΅M riboflavin, 25 mM methionine, 90 Β΅M NBT | 8.2 | 45Β°C | ? mM H+, ? mM Oββ» | HβOβ (Hydrogen Peroxide) , Oβ | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (measurement of NBT-formazan absorbance decline due to superoxide radicals production, 560 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 10% | 100.0 | 118.8 | % | 100 mM potassium phosphate buffer, 0.5 MM EDTA, 7 Β΅M riboflavin, 25 mM methionine, 90 Β΅M NBT | 8.2 | 45Β°C | ? mM H+, ? mM Oββ» | HβOβ (Hydrogen Peroxide) , Oβ | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (measurement of NBT-formazan absorbance decline due to superoxide radicals production, 560 nm) in the presence of organic solvent | n-Hexane | 5% | 100.0 | 41.6 | % | 100 mM potassium phosphate buffer, 0.5 MM EDTA, 7 Β΅M riboflavin, 25 mM methionine, 90 Β΅M NBT | 8.2 | 45Β°C | ? mM H+, ? mM Oββ» | HβOβ (Hydrogen Peroxide) , Oβ | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (measurement of NBT-formazan absorbance decline due to superoxide radicals production, 560 nm) in the presence of organic solvent | n-Hexane | 10% | 100.0 | 40.3 | % | 100 mM potassium phosphate buffer, 0.5 MM EDTA, 7 Β΅M riboflavin, 25 mM methionine, 90 Β΅M NBT | 8.2 | 45Β°C | ? mM H+, ? mM Oββ» | HβOβ (Hydrogen Peroxide) , Oβ | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.