N-terminal truncated lipolytic enzyme (gene PanLipΞ”N) from Pseudonocardia antarctica

Enzyme Description

Species
Pseudonocardia antarctica β†—
Extremophile
Yes "psychrophilic" organism
EC Number
3.1.1.1 β†—

Sequence

Length: 309 amino acids
GPALSVPPDQLDAAVRCSANATDADRDVALFVPGTTLTPEVNFGFNWFAALDDLGRPYCSVTLPNNAMTDTQIAAEYVVHAI RHVHGISGRKVDVLGHSQGGTEPRFALRFWPDLRGMVDDYVAFGTTNHGSIAINAALCTPATGCAEALWQQTLNSH YTQAMNSYQETFAGISYTQIYTRTDEFVQPNLDDSGTTSLHGGGGEISNVALQDVCLTEAASEHIAVGTYSPVAYALATDALDHDGPADPARVDRGVCTQVFMPGVDPLTFPTDYAATLGLIANQLALAPRVGSEPELRPYTLADDRQG
Lixiao Liu et al. (2025) β€” A CALB-like Cold-Active Lipolytic Enzyme from Pseudonocardia antarctica: Expression, Biochemical Characterization, and AlphaFold-Guided Dynamics
Marine Drugs  Β· doi:10.3390/md23120480 β†—  Β· Stability - Incubation
18 measurements ▼
Database ID
β€”
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (18 measurements)

18 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase n-Hexane 10% 100 62 % Incubation: ?, Assay: 200 mM Tris–HCl, 100 mM NaCl Incubation: ?, Assay: 7.4 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name
Stability - Incubation Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 3% 100 55 % Incubation: ?, Assay: 200 mM Tris–HCl, 100 mM NaCl Incubation: ?, Assay: 7.4 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name
Stability - Incubation Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 2% 100 103 % Incubation: ?, Assay: 200 mM Tris–HCl, 100 mM NaCl Incubation: ?, Assay: 7.4 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name
Stability - Incubation Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 1% 100 105 % Incubation: ?, Assay: 200 mM Tris–HCl, 100 mM NaCl Incubation: ?, Assay: 7.4 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name
Stability - Incubation Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetonitrile 50% 100 8 % Incubation: ?, Assay: 200 mM Tris–HCl, 100 mM NaCl Incubation: ?, Assay: 7.4 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name
Stability - Incubation Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetonitrile 25% 100 45 % Incubation: ?, Assay: 200 mM Tris–HCl, 100 mM NaCl Incubation: ?, Assay: 7.4 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name
Stability - Incubation Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetonitrile 10% 100 89 % Incubation: ?, Assay: 200 mM Tris–HCl, 100 mM NaCl Incubation: ?, Assay: 7.4 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name
Stability - Incubation Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase n-Hexane 50% 100 110 % Incubation: ?, Assay: 200 mM Tris–HCl, 100 mM NaCl Incubation: ?, Assay: 7.4 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name
Stability - Incubation Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase n-Hexane 25% 100 92 % Incubation: ?, Assay: 200 mM Tris–HCl, 100 mM NaCl Incubation: ?, Assay: 7.4 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name
Stability - Incubation Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 10% 100 80 % Incubation: ?, Assay: 200 mM Tris–HCl, 100 mM NaCl Incubation: ?, Assay: 7.4 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name
Stability - Incubation Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 50% 100 104 % Incubation: ?, Assay: 200 mM Tris–HCl, 100 mM NaCl Incubation: ?, Assay: 7.4 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name
Stability - Incubation Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 25% 100 92 % Incubation: ?, Assay: 200 mM Tris–HCl, 100 mM NaCl Incubation: ?, Assay: 7.4 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name
Stability - Incubation Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 10% 100 72 % Incubation: ?, Assay: 200 mM Tris–HCl, 100 mM NaCl Incubation: ?, Assay: 7.4 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name
Stability - Incubation Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 50% 100 31 % Incubation: ?, Assay: 200 mM Tris–HCl, 100 mM NaCl Incubation: ?, Assay: 7.4 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name
Stability - Incubation Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 25% 100 82 % Incubation: ?, Assay: 200 mM Tris–HCl, 100 mM NaCl Incubation: ?, Assay: 7.4 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name
Stability - Incubation Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 10% 100 72 % Incubation: ?, Assay: 200 mM Tris–HCl, 100 mM NaCl Incubation: ?, Assay: 7.4 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name
Stability - Incubation Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 50% 100 31 % Incubation: ?, Assay: 200 mM Tris–HCl, 100 mM NaCl Incubation: ?, Assay: 7.4 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name
Stability - Incubation Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 25% 100 110 % Incubation: ?, Assay: 200 mM Tris–HCl, 100 mM NaCl Incubation: ?, Assay: 7.4 Incubation: 25Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl acetate Acetic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*