Lipase (gene PCLase0801) from Pseudomonas sp. DS0801
Enzyme Description
Sequence
MKKKSLLPLGLAIGLAPLAASPLIQASTYTQTKYPNVLAHGMLGFDNILGVDYWFGIPSALRRDGAQVYVTEVSQLDTSEVRGEQLLLQVEEIVALSGQPKVNLIGHSHGGPTIRYVAAVRPDLIASATSVGAPHKGSDTADFLRQIPPGSAGEAVLSGLVNSLGALISFLSSGSAGTQNSLGSLESLNSEGAARFNAKYPQGIPTSACGEGAYKVNGVSYYSWSGSSPLTNFLDPSDAFLGASSLTFKNGTANDGLVGTCSSHLGMVIRDNYRMNHLDEVNQVFGLTSLFETSPVSVYRQHANRLKNASL
Yao Di et al. (2025)
β Degradation and ring-opening polymerization of poly(Ξ΅-caprolactone) by a novel enzyme from Pseudomonas sp. DS0801
iScience
Β· doi:10.1016/j.isci.2025.114173 β
Β· Activity - Classical
▼
Database ID
NCBI: PX234425.1 β
Sequence Annotation
Explicit - Provided PDB Accession Number (1 mutation)
Protein Source
Purified, bacterium Pseudomonas sp. DS0801
Experimental Data (6 measurements)
6 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (reaction mixture turbidity absorbance measurement at 650 nm) in the presence of organic solvent | Ethanol | 1% | 100.0 | 95.6 | % | ? Buffer, Plysurf A210G for substrate solubilization | ? | 40Β°C | 0.1 % (w/v) Polycaprolactone | Polycaprolactone hydrolysis reaction products | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (reaction mixture turbidity absorbance measurement at 650 nm) in the presence of organic solvent | Methanol | 1% | 100.0 | 96.2 | % | ? Buffer, Plysurf A210G for substrate solubilization | ? | 40Β°C | 0.1 % (w/v) Polycaprolactone | Polycaprolactone hydrolysis reaction products | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (reaction mixture turbidity absorbance measurement at 650 nm) in the presence of organic solvent | Glycerol | 1% | 100.0 | 97.9 | % | ? Buffer, Plysurf A210G for substrate solubilization | ? | 40Β°C | 0.1 % (w/v) Polycaprolactone | Polycaprolactone hydrolysis reaction products | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (reaction mixture turbidity absorbance measurement at 650 nm) in the presence of organic solvent | Ethanol | 10% | 100.0 | 68.2 | % | ? Buffer, Plysurf A210G for substrate solubilization | ? | 40Β°C | 0.1 % (w/v) Polycaprolactone | Polycaprolactone hydrolysis reaction products | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (reaction mixture turbidity absorbance measurement at 650 nm) in the presence of organic solvent | Methanol | 10% | 100.0 | 82.3 | % | ? Buffer, Plysurf A210G for substrate solubilization | ? | 40Β°C | 0.1 % (w/v) Polycaprolactone | Polycaprolactone hydrolysis reaction products | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (reaction mixture turbidity absorbance measurement at 650 nm) in the presence of organic solvent | Glycerol | 10% | 100.0 | 78.4 | % | ? Buffer, Plysurf A210G for substrate solubilization | ? | 40Β°C | 0.1 % (w/v) Polycaprolactone | Polycaprolactone hydrolysis reaction products | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.