Pancreas lipase from Sus scrofa (pig)

Enzyme Description

Extremophile
No
EC Number
3.1.1.3 β†— (synthesis)

Sequence

Length: 465 amino acids
MLLIWTLSLLLGAVLGSEVCFPRLGCFSDDAPWAGIVQRPLKILPWDPKDVNTRFLLYTNENQDNYQELVADPSTITDSNFRMDRKTRFIIHGFIDKGEEDWLSNICKNLFKVESVNCICVDWKGGSRTGYTQASQNIRIVGAEVAYFVEVLKSSLGYSPSNVHVIGHSLGSHAAGEAGRRTNGTIERITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDAAPIIPNLGFGMSQVVGHLDFFPNGGKEMPGCQKNILSQIVDIDGIWEGTRDFVACNHLRSYKYYADSILNPDGFAGFPCDSYNVFTANKCFPCPSEGCPQMGHYADRFPGKTNGVSQVFYLNTGDASNFARWRYKVSVTLSGKKVTGHILVSLFGNEGNSRQYEIYKGTLQPDNTHSNEFDSDVEVGDLQKVKFIWYNNVINPTLPRVGASKITVERNDGKVYDFCSQETVREEVLLTLTPC
Li-Qiang Zhang et al. (2003) β€” Lipase-Catalyzed Synthesis of Precursor Dipeptides of RGD in Aqueous Water-Miscible Organic Solvents
Preparative Biochemistry and Biotechnology  Β· doi:10.1081/PB-120018365 β†—  Β· Activity + Stability - Product Formation
20 measurements
Database ID
UniProt: D4P6H2 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Commercially purchased

Experimental Data (20 measurements)

20 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + Stability - Product Formation Product yield after incubation in the presence of organic solvent, measured by HPLC Acetonitrile 50% 5.0 59.8 % 67 mM phosphate buffer 8 15Β°C 20 mM Benzyl-ArgOEt, 200 mM Gly-NH2 Benzyl-Arg-Gly-NH2 , Ethanol β€” Yes, "stirring" Classical aqueous control (in %) | Synthesis reaction
Activity + Stability - Product Formation Product yield after incubation in the presence of organic solvent, measured by HPLC Dimethyl Sulfoxide (DMSO) 50% 3.0 23.9 % 67 mM phosphate buffer 8 15Β°C 200 mM Asp-NH2, 20 mM CBZ-Gly Nitrophenyl ester CBZ-Gly-Asp-NH2 , p-Nitrophenol β€” Yes, "stirring" Classical aqueous control (in %) | Synthesis reaction
Activity + Stability - Product Formation Product yield after incubation in the presence of organic solvent, measured by HPLC Dimethylformamide (DMF) 50% 3.0 50.2 % 67 mM phosphate buffer 8 15Β°C 200 mM Asp-NH2, 20 mM CBZ-Gly Nitrophenyl ester CBZ-Gly-Asp-NH2 , p-Nitrophenol β€” Yes, "stirring" Classical aqueous control (in %) | Synthesis reaction
Activity + Stability - Product Formation Product yield after incubation in the presence of organic solvent, measured by HPLC Methanol 50% 3.0 67.8 % 67 mM phosphate buffer 8 15Β°C 200 mM Asp-NH2, 20 mM CBZ-Gly Nitrophenyl ester CBZ-Gly-Asp-NH2 , p-Nitrophenol β€” Yes, "stirring" Classical aqueous control (in %) | Synthesis reaction
Activity + Stability - Product Formation Product yield after incubation in the presence of organic solvent, measured by HPLC Pyridine 50% 3.0 63.6 % 67 mM phosphate buffer 8 15Β°C 200 mM Asp-NH2, 20 mM CBZ-Gly Nitrophenyl ester CBZ-Gly-Asp-NH2 , p-Nitrophenol β€” Yes, "stirring" Classical aqueous control (in %) | Synthesis reaction
Activity + Stability - Product Formation Product yield after incubation in the presence of organic solvent, measured by HPLC Acetonitrile 50% 3.0 12.7 % 67 mM phosphate buffer 8 15Β°C 200 mM Asp-NH2, 20 mM CBZ-Gly Nitrophenyl ester CBZ-Gly-Asp-NH2 , p-Nitrophenol β€” Yes, "stirring" Classical aqueous control (in %) | Synthesis reaction
Activity + Stability - Product Formation Product yield after incubation in the presence of organic solvent, measured by HPLC Dimethyl Sulfoxide (DMSO) 50% 5.0 55.9 % 67 mM phosphate buffer 8 15Β°C 20 mM Benzyl-ArgOEt, 200 mM Gly-NH2 Benzyl-Arg-Gly-NH2 , Ethanol β€” Yes, "stirring" Classical aqueous control (in %) | Synthesis reaction
Activity + Stability - Product Formation Product yield after incubation in the presence of organic solvent, measured by HPLC Dimethylformamide (DMF) 50% 5.0 73.6 % 67 mM phosphate buffer 8 15Β°C 20 mM Benzyl-ArgOEt, 200 mM Gly-NH2 Benzyl-Arg-Gly-NH2 , Ethanol β€” Yes, "stirring" Classical aqueous control (in %) | Synthesis reaction
Activity + Stability - Product Formation Product yield after incubation in the presence of organic solvent, measured by HPLC Methanol 50% 5.0 71.4 % 67 mM phosphate buffer 8 15Β°C 20 mM Benzyl-ArgOEt, 200 mM Gly-NH2 Benzyl-Arg-Gly-NH2 , Ethanol β€” Yes, "stirring" Classical aqueous control (in %) | Synthesis reaction
Activity + Stability - Product Formation Product yield after incubation in the presence of organic solvent, measured by HPLC Pyridine 50% 5.0 64.8 % 67 mM phosphate buffer 8 15Β°C 20 mM Benzyl-ArgOEt, 200 mM Gly-NH2 Benzyl-Arg-Gly-NH2 , Ethanol β€” Yes, "stirring" Classical aqueous control (in %) | Synthesis reaction
Activity + Stability - Product Formation Product yield after incubation in the presence of organic solvent, measured by HPLC Methanol 30% 5.0 58.0 % 67 mM phosphate buffer 8 15Β°C 20 mM Benzyl-ArgOEt, 200 mM Gly-NH2 Benzyl-Arg-Gly-NH2 , Ethanol β€” Yes, "stirring" Classical aqueous control (in %) | Synthesis reaction
Activity + Stability - Product Formation Product yield after incubation in the presence of organic solvent, measured by HPLC Methanol 100% 3.0 3.0 % 67 mM phosphate buffer 8 15Β°C 200 mM Asp-NH2, 20 mM CBZ-Gly Nitrophenyl ester CBZ-Gly-Asp-NH2 , p-Nitrophenol β€” Yes, "stirring" Classical aqueous control (in %) | Synthesis reaction
Activity + Stability - Product Formation Product yield after incubation in the presence of organic solvent, measured by HPLC Methanol 80% 3.0 45.0 % 67 mM phosphate buffer 8 15Β°C 200 mM Asp-NH2, 20 mM CBZ-Gly Nitrophenyl ester CBZ-Gly-Asp-NH2 , p-Nitrophenol β€” Yes, "stirring" Classical aqueous control (in %) | Synthesis reaction
Activity + Stability - Product Formation Product yield after incubation in the presence of organic solvent, measured by HPLC Methanol 50% 3.0 58.0 % 67 mM phosphate buffer 8 15Β°C 200 mM Asp-NH2, 20 mM CBZ-Gly Nitrophenyl ester CBZ-Gly-Asp-NH2 , p-Nitrophenol β€” Yes, "stirring" Classical aqueous control (in %) | Synthesis reaction
Activity + Stability - Product Formation Product yield after incubation in the presence of organic solvent, measured by HPLC Methanol 40% 3.0 67.0 % 67 mM phosphate buffer 8 15Β°C 200 mM Asp-NH2, 20 mM CBZ-Gly Nitrophenyl ester CBZ-Gly-Asp-NH2 , p-Nitrophenol β€” Yes, "stirring" Classical aqueous control (in %) | Synthesis reaction
Activity + Stability - Product Formation Product yield after incubation in the presence of organic solvent, measured by HPLC Methanol 30% 3.0 40.0 % 67 mM phosphate buffer 8 15Β°C 200 mM Asp-NH2, 20 mM CBZ-Gly Nitrophenyl ester CBZ-Gly-Asp-NH2 , p-Nitrophenol β€” Yes, "stirring" Classical aqueous control (in %) | Synthesis reaction
Activity + Stability - Product Formation Product yield after incubation in the presence of organic solvent, measured by HPLC Methanol 100% 5.0 0.0 % 67 mM phosphate buffer 8 15Β°C 20 mM Benzyl-ArgOEt, 200 mM Gly-NH2 Benzyl-Arg-Gly-NH2 , Ethanol β€” Yes, "stirring" Classical aqueous control (in %) | Synthesis reaction
Activity + Stability - Product Formation Product yield after incubation in the presence of organic solvent, measured by HPLC Methanol 80% 5.0 15.0 % 67 mM phosphate buffer 8 15Β°C 20 mM Benzyl-ArgOEt, 200 mM Gly-NH2 Benzyl-Arg-Gly-NH2 , Ethanol β€” Yes, "stirring" Classical aqueous control (in %) | Synthesis reaction
Activity + Stability - Product Formation Product yield after incubation in the presence of organic solvent, measured by HPLC Methanol 50% 5.0 72.0 % 67 mM phosphate buffer 8 15Β°C 20 mM Benzyl-ArgOEt, 200 mM Gly-NH2 Benzyl-Arg-Gly-NH2 , Ethanol β€” Yes, "stirring" Classical aqueous control (in %) | Synthesis reaction
Activity + Stability - Product Formation Product yield after incubation in the presence of organic solvent, measured by HPLC Methanol 40% 5.0 69.0 % 67 mM phosphate buffer 8 15Β°C 20 mM Benzyl-ArgOEt, 200 mM Gly-NH2 Benzyl-Arg-Gly-NH2 , Ethanol β€” Yes, "stirring" Classical aqueous control (in %) | Synthesis reaction

Visualization : Activity + Stability β€” Product Formation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*