Multicopper oxidase (gene BmLMCO) from Bacillus mojavensis TH309
Enzyme Description
Sequence
MTLEKFADALPIPDTLKPVQQSKDSTYYAVTMEECYHQLHRDLPPTRLWGYNGLFPGPTGEAFRNENVYVKWMFNLPSIHFLPIGHTIFHSDSQHAEVEVWAHDHAMALTRLNVYAGLIGAYAIHDPKEKRLKLPSGEYDVPLLITARTINEDGSLFYPSGPENPSHHCASSIVSFWRRQQFSSTEHAYMSRTRDYAPRHHASIPRHILASLGYAVHYGSIGRTLRIRQAGGLLPRSVDLNSASIAPCAERFDILIDWFAAFEGQSIIIANSEGAGGDVNPETDANIMQFRVTKPLAQKDESRKGPKYLAGSYPSVQHRAIQNLRTLKLAGTQDQHHYGTRPVLLLHNKRWHHDPVTEAGKAGSTEVWSIINPTRGTHPIHLHLVSFRAGLDRRPFDTARSEERGELFYTGPAVPFTPHSEKGFWKDTVIDSHGGEVLRIAVTFGPYTSRYAVTFGPYTSRYDPHK
Ali Osman AdigΓΌzel et al. (2023)
β Heterologous expression, purification, and characterization of thermo- and alkali-tolerant laccase-like multicopper oxidase from Bacillus mojavensis TH309 and determination of its antibiotic removal potential
Archives of Microbiology
Β· doi:10.1007/s00203-023-03626-5 β
Β· Activity - Classical
▼
Database ID
β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (14 measurements)
14 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical reaction products absorbance measurement, 470 nm) in the presence of organic solvent | Ethanol | 10% | 100.0 | 62.8 | % | 50 mM Tris-HCl buffer | 8 | 80Β°C | 2.96 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 0.27 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical reaction products absorbance measurement, 470 nm) in the presence of organic solvent | Ethanol | 30% | 100.0 | 81.4 | % | 50 mM Tris-HCl buffer | 8 | 80Β°C | 2.96 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 0.27 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical reaction products absorbance measurement, 470 nm) in the presence of organic solvent | Acetone | 10% | 100.0 | 80.0 | % | 50 mM Tris-HCl buffer | 8 | 80Β°C | 2.96 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 0.27 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical reaction products absorbance measurement, 470 nm) in the presence of organic solvent | Acetone | 30% | 100.0 | 115.8 | % | 50 mM Tris-HCl buffer | 8 | 80Β°C | 2.96 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 0.27 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical reaction products absorbance measurement, 470 nm) in the presence of organic solvent | Methanol | 10% | 100.0 | 86.4 | % | 50 mM Tris-HCl buffer | 8 | 80Β°C | 2.96 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 0.27 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical reaction products absorbance measurement, 470 nm) in the presence of organic solvent | Methanol | 30% | 100.0 | 86.1 | % | 50 mM Tris-HCl buffer | 8 | 80Β°C | 2.96 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 0.27 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical reaction products absorbance measurement, 470 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 10% | 100.0 | 78.6 | % | 50 mM Tris-HCl buffer | 8 | 80Β°C | 2.96 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 0.27 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical reaction products absorbance measurement, 470 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 30% | 100.0 | 92.2 | % | 50 mM Tris-HCl buffer | 8 | 80Β°C | 2.96 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 0.27 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical reaction products absorbance measurement, 470 nm) in the presence of organic solvent | Chloroform | 10% | 100.0 | 98.6 | % | 50 mM Tris-HCl buffer | 8 | 80Β°C | 2.96 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 0.27 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical reaction products absorbance measurement, 470 nm) in the presence of organic solvent | Chloroform | 30% | 100.0 | 124.2 | % | 50 mM Tris-HCl buffer | 8 | 80Β°C | 2.96 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 0.27 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical reaction products absorbance measurement, 470 nm) in the presence of organic solvent | 1-Butanol | 10% | 100.0 | 75.6 | % | 50 mM Tris-HCl buffer | 8 | 80Β°C | 2.96 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 0.27 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical reaction products absorbance measurement, 470 nm) in the presence of organic solvent | 1-Butanol | 30% | 100.0 | 88.3 | % | 50 mM Tris-HCl buffer | 8 | 80Β°C | 2.96 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 0.27 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical reaction products absorbance measurement, 470 nm) in the presence of organic solvent | Isopropanol | 10% | 100.0 | 99.7 | % | 50 mM Tris-HCl buffer | 8 | 80Β°C | 2.96 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 0.27 mM CuCl2 | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (2.6-dimethoxyphenoxy radical reaction products absorbance measurement, 470 nm) in the presence of organic solvent | Isopropanol | 30% | 100.0 | 108.0 | % | 50 mM Tris-HCl buffer | 8 | 80Β°C | 2.96 mM 2,6-Dimethoxyphenol | 2,6-dimethoxyphenoxy radical | 0.27 mM CuCl2 | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.