Uncharacterized hydrolase (gene dehpH) from Mycolicibacterium phocaicum RL-HY01

Enzyme Description

Extremophile
No but"cold-adapted" enzyme
EC Number

Sequence

Length: 383 amino acids
MTMSMPGDAVRAAATTDAELVVRPEHPTAGRPSRLRLATLTRIGGTALRILPKIPDRLKRVLLRGRRVTIDGNTLDTTLLMLTAQNASGAGGLVASSDVTVARAEIARLSQGLDPGIAVATTDFTIPGPTEQLRARHYQPDGTGPAPMLVFFHGGGFVVGGCIESHDGLCRLISRDAGVHVVSVEYRLAPEHPAPAASDDCYATYLWCVENAARLGADPAKIAVGGDSAGGNLAAVVSQLARDNHKPLPALQLLIYPVTNFAGDTRSKVLFADGYFLSKIDMDWFRANYLAESALDPSDPRVSPLLAEDLSGLPPALVLTGGFDPLRDEGDAYAAALAAAGVPVDHRRYGSLIHAFANFFPLGGDSAVATADFISAFRAHLTR
Lei Ren et al. (2025) β€” Identification and Characterization of a Novel Di-(2-ethylhexyl) Phthalate Hydrolase from a Marine Bacterial Strain Mycolicibacterium phocaicum RL-HY01
International Journal of Molecular Sciences  Β· doi:10.3390/ijms26178141 β†—  Β· Activity - Classical
7 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (7 measurements)

7 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by gas chromatography (substrate DEHP concentration measurement) Methanol 1% 100.0 92.3 % 50 mM Tris-HCl buffer 8 30Β°C 200 Β΅M Di(2-ethylhexyl) phthalate 2-Ethylhexanol , Mono-(2-ethylhexyl) phthalate (MEHP) β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by gas chromatography (substrate DEHP concentration measurement) Ethanol 1% 100.0 94.9 % 50 mM Tris-HCl buffer 8 30Β°C 200 Β΅M Di(2-ethylhexyl) phthalate 2-Ethylhexanol , Mono-(2-ethylhexyl) phthalate (MEHP) β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by gas chromatography (substrate DEHP concentration measurement) Isopropanol 1% 100.0 89.2 % 50 mM Tris-HCl buffer 8 30Β°C 200 Β΅M Di(2-ethylhexyl) phthalate 2-Ethylhexanol , Mono-(2-ethylhexyl) phthalate (MEHP) β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by gas chromatography (substrate DEHP concentration measurement) Acetone 1% 100.0 88.5 % 50 mM Tris-HCl buffer 8 30Β°C 200 Β΅M Di(2-ethylhexyl) phthalate 2-Ethylhexanol , Mono-(2-ethylhexyl) phthalate (MEHP) β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by gas chromatography (substrate DEHP concentration measurement) Acetonitrile 1% 100.0 89.6 % 50 mM Tris-HCl buffer 8 30Β°C 200 Β΅M Di(2-ethylhexyl) phthalate 2-Ethylhexanol , Mono-(2-ethylhexyl) phthalate (MEHP) β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by gas chromatography (substrate DEHP concentration measurement) Ethyl Acetate 1% 100.0 99.1 % 50 mM Tris-HCl buffer 8 30Β°C 200 Β΅M Di(2-ethylhexyl) phthalate 2-Ethylhexanol , Mono-(2-ethylhexyl) phthalate (MEHP) β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by gas chromatography (substrate DEHP concentration measurement) n-Hexane 1% 100.0 97.8 % 50 mM Tris-HCl buffer 8 30Β°C 200 Β΅M Di(2-ethylhexyl) phthalate 2-Ethylhexanol , Mono-(2-ethylhexyl) phthalate (MEHP) β€” β€” Classical aqueous control (in %)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*